KEGG   Pan paniscus (bonobo): 100975164
Entry
100975164         CDS       T02283                                 

Gene name
GNAL
Definition
(RefSeq) G protein subunit alpha L
  KO
K04633  guanine nucleotide-binding protein G(olf) subunit alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04728  Dopaminergic synapse
pps04740  Olfactory transduction
pps05012  Parkinson disease
pps05142  Chagas disease
pps05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100975164 (GNAL)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100975164 (GNAL)
  09157 Sensory system
   04740 Olfactory transduction
    100975164 (GNAL)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100975164 (GNAL)
   05142 Chagas disease
    100975164 (GNAL)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100975164 (GNAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100975164 (GNAL)
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100975164 (GNAL)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU
Other DBs
NCBI-GeneID: 100975164
NCBI-ProteinID: XP_008962349
UniProt: A0A2R8ZVR8
Position
18
AA seq 174 aa
MFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNR
WLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFF
IRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtttgatgttggtggccagagggatgagaggagaaaatggatccagtgctttaacgat
gtcacagctatcatttacgtcgcagcctgcagtagctacaacatggtgattcgagaagat
aacaacaccaacaggctgagagagtccctggatctttttgaaagcatctggaacaacagg
tggttacggaccatttctatcatcttgttcttgaacaaacaagatatgctggcagaaaaa
gtcttggcagggaaatcaaaaattgaagactatttcccagaatatgcaaattatactgtt
cctgaagacgcaacaccagatgcaggagaagatcccaaagttacaagagccaagttcttt
atccgggacctgtttttgaggatcagcacggccaccggtgatggcaaacattactgctac
ccgcacttcacctgcgccgtggacacagagaacatccgcagggtgttcaacgactgccgc
gacatcatccagcggatgcacctcaagcagtatgagctcttgtga

KEGG   Pan paniscus (bonobo): 100978090
Entry
100978090         CDS       T02283                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04724  Glutamatergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04962  Vasopressin-regulated water reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05012  Parkinson disease
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05034  Alcoholism
pps05142  Chagas disease
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100978090
   04020 Calcium signaling pathway
    100978090
   04072 Phospholipase D signaling pathway
    100978090
   04024 cAMP signaling pathway
    100978090
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100978090
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978090
  09152 Endocrine system
   04911 Insulin secretion
    100978090
   04922 Glucagon signaling pathway
    100978090
   04923 Regulation of lipolysis in adipocytes
    100978090
   04912 GnRH signaling pathway
    100978090
   04913 Ovarian steroidogenesis
    100978090
   04915 Estrogen signaling pathway
    100978090
   04921 Oxytocin signaling pathway
    100978090
   04926 Relaxin signaling pathway
    100978090
   04935 Growth hormone synthesis, secretion and action
    100978090
   04918 Thyroid hormone synthesis
    100978090
   04928 Parathyroid hormone synthesis, secretion and action
    100978090
   04916 Melanogenesis
    100978090
   04924 Renin secretion
    100978090
   04925 Aldosterone synthesis and secretion
    100978090
   04927 Cortisol synthesis and secretion
    100978090
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978090
   04270 Vascular smooth muscle contraction
    100978090
  09154 Digestive system
   04970 Salivary secretion
    100978090
   04971 Gastric acid secretion
    100978090
   04972 Pancreatic secretion
    100978090
   04976 Bile secretion
    100978090
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100978090
   04961 Endocrine and other factor-regulated calcium reabsorption
    100978090
  09156 Nervous system
   04724 Glutamatergic synapse
    100978090
   04728 Dopaminergic synapse
    100978090
   04726 Serotonergic synapse
    100978090
   04730 Long-term depression
    100978090
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100978090
  09159 Environmental adaptation
   04713 Circadian entrainment
    100978090
   04714 Thermogenesis
    100978090
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978090
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100978090
   05165 Human papillomavirus infection
    100978090
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100978090
   05142 Chagas disease
    100978090
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100978090
  09165 Substance dependence
   05030 Cocaine addiction
    100978090
   05031 Amphetamine addiction
    100978090
   05032 Morphine addiction
    100978090
   05034 Alcoholism
    100978090
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100978090
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100978090
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100978090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100978090
   04031 GTP-binding proteins [BR:pps04031]
    100978090
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100978090
  Exosomal proteins of other body fluids (saliva and urine)
   100978090
  Exosomal proteins of colorectal cancer cells
   100978090
  Exosomal proteins of bladder cancer cells
   100978090
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100978090
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc
Other DBs
NCBI-GeneID: 100978090
NCBI-ProteinID: XP_008961425
Position
20
AA seq 336 aa
MRILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE
LANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYF
LDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCF
NDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLA
EKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHY
CYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggct
gcaaggagcaacagcgatggcagtgagaaggcaaccaaagtgcaggacatcaaaaacaac
ctgaaagaggcgattgaaaccattgtggccgccatgagcaacctggtgccccccgtggag
ctggccaaccccgagaaccagttcagagtggactacattctgagtgtgatgaacgtgcct
gactttgacttccctcccgaattctatgagcatgccaaggctctgtgggaggatgaagga
gtgcgtgcctgctatgaacgctccaacgagtaccagctgattgactgtgcccagtacttc
ctggacaagatcgacgtgatcaagcaggctgactacgtgccgagcgatcaggacctgctt
cgctgccgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaac
ttccacatgtttgacgtgggtggccagcgcgatgaacgccgcaagtggatccagtgcttc
aacgatgtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgg
gaggacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaac
aacagatggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctgctcgct
gagaaagtccttgctgggaaatcgaagattgaggactactttccagaatttgctcgctac
actactcctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaag
tacttcattcgagatgagtttctgaggatcagcactgccagtggagatgggcgtcactac
tgctaccctcatttcacctgcgctgtggacactgagaacatccgccgtgtgttcaacgac
tgccgtgacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

KEGG   Pan paniscus (bonobo): 100990650
Entry
100990650         CDS       T02283                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04724  Glutamatergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04962  Vasopressin-regulated water reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05012  Parkinson disease
pps05030  Cocaine addiction
pps05031  Amphetamine addiction
pps05032  Morphine addiction
pps05034  Alcoholism
pps05142  Chagas disease
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100990650
   04020 Calcium signaling pathway
    100990650
   04072 Phospholipase D signaling pathway
    100990650
   04024 cAMP signaling pathway
    100990650
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100990650
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100990650
  09152 Endocrine system
   04911 Insulin secretion
    100990650
   04922 Glucagon signaling pathway
    100990650
   04923 Regulation of lipolysis in adipocytes
    100990650
   04912 GnRH signaling pathway
    100990650
   04913 Ovarian steroidogenesis
    100990650
   04915 Estrogen signaling pathway
    100990650
   04921 Oxytocin signaling pathway
    100990650
   04926 Relaxin signaling pathway
    100990650
   04935 Growth hormone synthesis, secretion and action
    100990650
   04918 Thyroid hormone synthesis
    100990650
   04928 Parathyroid hormone synthesis, secretion and action
    100990650
   04916 Melanogenesis
    100990650
   04924 Renin secretion
    100990650
   04925 Aldosterone synthesis and secretion
    100990650
   04927 Cortisol synthesis and secretion
    100990650
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100990650
   04270 Vascular smooth muscle contraction
    100990650
  09154 Digestive system
   04970 Salivary secretion
    100990650
   04971 Gastric acid secretion
    100990650
   04972 Pancreatic secretion
    100990650
   04976 Bile secretion
    100990650
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100990650
   04961 Endocrine and other factor-regulated calcium reabsorption
    100990650
  09156 Nervous system
   04724 Glutamatergic synapse
    100990650
   04728 Dopaminergic synapse
    100990650
   04726 Serotonergic synapse
    100990650
   04730 Long-term depression
    100990650
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100990650
  09159 Environmental adaptation
   04713 Circadian entrainment
    100990650
   04714 Thermogenesis
    100990650
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990650
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100990650
   05165 Human papillomavirus infection
    100990650
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100990650
   05142 Chagas disease
    100990650
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100990650
  09165 Substance dependence
   05030 Cocaine addiction
    100990650
   05031 Amphetamine addiction
    100990650
   05032 Morphine addiction
    100990650
   05034 Alcoholism
    100990650
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100990650
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100990650
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100990650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100990650
   04031 GTP-binding proteins [BR:pps04031]
    100990650
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100990650
  Exosomal proteins of other body fluids (saliva and urine)
   100990650
  Exosomal proteins of colorectal cancer cells
   100990650
  Exosomal proteins of bladder cancer cells
   100990650
GTP-binding proteins [BR:pps04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100990650
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 100990650
NCBI-ProteinID: XP_003806229
UniProt: A0A2R9AWI4
Position
20
AA seq 245 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPP
STQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPI
PIRRH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgtgcccagcagcgcgcggctgcccaacag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtattccctgagtccccc
gaatcggaatctgaccacgagcacgaggaggcagaccttgagctgtccctccccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgagtccgaaatcgag
tccgagaccgacttcgagaccgagcctgagaccgcccccaccactgagcccgagaccgag
cctgaagacgatcgcggcccggtggtgcccaagcactccaccttcggccagtccctcacc
cagcgtctgcacgctctcaagttgcgaagccccgacgcctccccaagtcgcgcgccgccc
agcactcaggagccccagagccccagggaaggggaggagctcaagcccgaggacaaagat
ccaagggaccccgaagagtcgaaggagcccaaggaggagaagcagcggcgtcgctgcaag
ccaaagaagcccacccgccgtgacgcgtccccggagtccccttccaaaaagggacccatc
cccatccggcgtcactaa

DBGET integrated database retrieval system