KEGG   Pan paniscus (bonobo): 100975220
Entry
100975220         CDS       T02283                                 

Gene name
TIRAP
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04620  Toll-like receptor signaling pathway
pps05132  Salmonella infection
pps05133  Pertussis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100975220 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100975220 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100975220 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100975220 (TIRAP)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100975220 (TIRAP)
   05133 Pertussis
    100975220 (TIRAP)
   05152 Tuberculosis
    100975220 (TIRAP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100975220 (TIRAP)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 100975220
NCBI-ProteinID: NP_001266132
UniProt: B3Y686
Position
11
AA seq 221 aa
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctggctctcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagaggcccaactcccca
gaaagcacctccagcgatgcttcacagcctacctcacaggacagcccactacccccaagc
ctcagctcagtcacgtctcccagcctgccacccacacacgcgagtgacagcggcagtagt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaggaagacctggtggccgcc
caggacctggtctcctacttggaaggcagcactgccagcctgcgctgcttcctgcaactc
cgggatgcaaccccaggcggcgctatcgtgtccgagctgtgccaggcactgagcagtagt
cactgccgggtgctgctcatcacgccgggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgaggctccaggggccgagggctgcaccatccccctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtactacgtcgatggcagg
ggccctgatggtggctttcgtcaagtcaaagaagctgtcatgcgttatctgcagacactc
agttga

DBGET integrated database retrieval system