KEGG   Pan paniscus (bonobo): 100975357
Entry
100975357         CDS       T02283                                 

Gene name
MCOLN2
Definition
(RefSeq) mucolipin 2
  KO
K04993  mucolipin 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100975357 (MCOLN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100975357 (MCOLN2)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100975357 (MCOLN2)
SSDB
Motif
Pfam: PKD_channel Ion_trans
Other DBs
NCBI-GeneID: 100975357
NCBI-ProteinID: XP_003805336
UniProt: A0A2R9B5J6
Position
1
AA seq 566 aa
MARQPYRFPQARIPERGSGVFGLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARR
QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDEDDYSCS
VYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETL
NIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSREL
PDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNILGSTQKNAQYVLVFDAFVIVI
CLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIG
SILKMEIKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRF
CACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVW
LFSRLYLYSFISLFIYMILSLFIALITDSYDTIKKFQQNGFPETDLQEFLKECSSKEEYQ
KESSAFLSCICCRRRKRSDDHLIPIS
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggcccggcagccttatcgttttccccaggcaaggattccggagagaggatcaggtgtt
ttcgggttaaccgtcagaaatgcaatggcacatcgtgattctgagatgaaagaagaatgt
ctaagggaagacctgaagttttacttcatgagcccttgtgaaaaataccgagccagacgc
cagattccgtggaaactgggtttgcagattttgaagatagtcatggtcaccacacagctt
gttcgttttggtttaagtaaccagctggtggttgctttcaaagaagataacactgttgct
tttaagcacttgtttttgaaaggatattctggtacagatgaagatgactacagctgcagt
gtatatactcaagaggatgcctatgagagcatcttttttgctattaatcagtatcatcag
ctaaaggacattaccctggggacccttggttatggagaaaatgaagacaatagaattggc
ttaaaagtctgtaagcagcattacaagaaagggaccatgtttccttctaatgagacactg
aatattgacaacgacgttgagctcgattgtgttcaattagaccttcaggacctctccaag
aagcctccggactggaagaactcatcattcttcagactggaattttatcggctcttacag
gttgaaatctcctttcatcttaaaggcattgacctacaaacaattcattcccgtgagtta
ccagactgttatgtctttcagaatacgattatctttgacaataaagctcacagtggcaaa
atcaaaatctattttgacagtgatgccaaaattgaagaatgtaaagacttgaacatactt
ggatctactcagaaaaatgctcagtatgtcctggtgtttgatgcatttgtcattgtgatt
tgcttggcatctcttattctgtgtacaagatccattgttcttgctctaaggttacggaag
agatttctaaatttcttcctggagaagtacaagcggcctgtgtgtgacaccgaccagtgg
gagttcatcaacggctggtatgtcctggtgattatcagcgacctaatgacaatcattggc
tccatattaaaaatggaaatcaaagcaaagaatctcacaaactatgatctctgcagcatt
tttcttggaacctctacgctcttggtttgggttggagtcatcagatacctgggttatttc
caggcatataatgtgctgattttaacaatgcaggcctcactgccaaaagttcttcggttt
tgtgcttgtgctggtatgatttatctgggttacacattctgtggctggattgtcttagga
ccataccatgacaagtttgaaaatctgaacacagttgctgagtgtctgttttctctggtc
aacggtgatgacatgtttgcaacctttgcccaaatccagcagaagagcatcttggtgtgg
ctgttcagtcgtctgtatttatattccttcatcagcctttttatatatatgattctcagt
ctttttattgcacttattacagattcttatgacaccattaagaaattccaacagaatggg
tttcctgaaacggatttgcaggaattcctgaaggaatgcagtagcaaagaagagtatcag
aaagagtcctcagccttcctgtcctgcatctgctgtcggaggaggaaaagaagtgatgat
cacttgatacctattagctaa

KEGG   Pan paniscus (bonobo): 100975689
Entry
100975689         CDS       T02283                                 

Gene name
MCOLN3
Definition
(RefSeq) mucolipin 3
  KO
K04994  mucolipin 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100975689 (MCOLN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100975689 (MCOLN3)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100975689 (MCOLN3)
SSDB
Motif
Pfam: PKD_channel Ion_trans
Other DBs
NCBI-GeneID: 100975689
NCBI-ProteinID: XP_003805337
Position
1
AA seq 553 aa
MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
DVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPE
IETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVDLQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSL
ILCIRSVIRGLQLQQEFVNFFLLHYKKGVSVSDQMEFVNGWYIMIIISDILTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLE
DDPPVSLFCCCKK
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcagatcctgaggtagttgtgagtagctgcagctctcatgaagaggaaaatcgctgc
aattttaaccagcaaacatctccatctgaggagcttctattagaagaccagatgaggcga
aaactcaaattttttttcatgaatccctgtgagaagttctgggctcgaggtagaaaacca
tggaaacttgccatacaaattctaaaaattgcaatggtgactatccagctggtcttattt
gggctaagtaaccagatggtggtagctttcaaggaagagaatactatagcattcaaacac
cttttcctaaaaggatatatggaccgaatggatgacacatatgcagtgtacacacaaagt
gacgtgtatgatcagttaatcttcgcagtaaaccagtacttgcagctatacaatgtctcc
gttgggaatcatgcttatgagaacaaaggtaccaagcaatctgctatggcaatctgtcag
cacttctacaagcgaggaaacatctaccctggaaatgatacctttgacatcgatccagaa
attgaaactgagtgtttctttgtggagccagatgaaccttttcacattgggacaccagca
gaaaataaactgaacttaacactggacttccacagactcctaacagtggaccttcagttt
aaactgaaagccattaatctgcagacagttcgtcatcaagaactccctgactgttatgac
tttactctgactataacatttgacaacaaggcccatagtggaagaattaaaataagttta
gataatgacatttccatcagagaatgtaaagactggcatgtatctggatcaattcagaag
aacactcattacatgatgatctttgatgcctttgtcattctgacttgcttggtttcatta
atcctctgcattagatctgtgattagaggacttcagcttcagcaggagtttgtcaatttt
ttcctcctccattataagaagggagtttctgtttctgatcaaatggaatttgtcaatgga
tggtacattatgattattattagtgacatattgacaatcattggatcaattctaaaaatg
gaaatccaagctaagagtctaactagttatgatgtctgtagcatacttcttgggacttct
accatgcttgtgtggcttggagtcatccgatacctcggtttctttgcaaagtacaatctc
ctcattttgacccttcaggcagcgctgcccaatgtcatcaggttctgctgctgtgcagct
atgatttacttaggttactgcttctgtggatggatcgtgctggggccttaccatgacaag
tttcgttctctgaacatggtctctgagtgccttttctctctgataaatggagatgatatg
tttgccacgtttgcaaaaatgcagcaaaaaagttacttagtctggctgtttagtagaatt
tacctctactcattcatcagcctctttatatatatgattttaagtcttttcattgcactg
atcactgatacatacgaaacaattaagcaataccaacaagatggcttcccagagactgaa
cttcgtacatttatatcagaatgcaaagatctacccaactctggaaaatacagattagaa
gatgaccctccagtatctttattctgctgttgtaaaaagtag

KEGG   Pan paniscus (bonobo): 100985054
Entry
100985054         CDS       T02283                                 

Gene name
MCOLN1
Definition
(RefSeq) mucolipin 1
  KO
K04992  mucolipin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100985054 (MCOLN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100985054 (MCOLN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100985054 (MCOLN1)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100985054 (MCOLN1)
SSDB
Motif
Pfam: PKD_channel DUF1866 Ion_trans
Other DBs
NCBI-GeneID: 100985054
NCBI-ProteinID: XP_003810065
UniProt: A0A2R9B983
Position
19
AA seq 580 aa
MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKG
RKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAY
TREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPAND
TFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTI
NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLL
FDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVT
SDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRV
ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAY
IAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSEEHSLLVN
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgacagccccggcgggtccgcgcggctcagagaccgagcggcttctgacccccaacccc
gggtatgggacccaggcggggccttcgccggcccctccgacacccccagaagaggaagac
cttcgccgtcgtctcaaatactttttcatgagtccctgcgacaagtttcgagccaagggc
cgcaagccctgcaagctgatgcttcaagtggtcaagatcctggtggtcacggtgcagctc
atcctgtttgggctcagtaatcagctggctgtgacattccgggaagagaacaccatcgcc
ttccgacacctcttcctgctgggctactcggacggagcggatgacaccttcgcagcctac
acgcgggagcagctgtaccaggccatcttccatgctgtggatcagtacctggcgttgcct
gacgtgtcactgggccggtatgcgtatgtccgtggtgggggtgacccttggaccaatggc
tcagggcttgctctctgccagcggtactaccaccgaggccacgtggacccggccaacgac
acatttgacattgatccgatggtggttactgactgcatccaggtggatccccccgagcgg
ccccctccgccccccagcgacgatctcaccctcttggaaagcagctccagttacaagaac
ctcacgctcaaattccacaagctggtcaatgtcaccatccacttccggctgaagaccatt
aacctccagagcctcatcaataatgagatcccggactgctataccttcagcgtcctgatc
acgtttgacaacaaagcacacagtgggcggatccccatcagcctggagacccaggcccac
atccaggagtgtaagcaccccagtgtcttccagcacggagacaacagcttccggctcctg
tttgatgtggtggtcatcctcacctgctccctgtccttcctcctctgcgcccgctcactc
cttcgaggcttcctgctgcagaacgagtttgtggggttcatgtggcggcagcggggacgg
gtcatcagcctgtgggagcggctggaatttgtcaatggctggtacatcctgctcgtcacc
agcgatgtgctcaccatctcgggcaccatcatgaagatcggcatcgaggccaagaacttg
gcgagctacgacgtctgcagcatcctcctgggcacctcgacgctgctggtgtgggtgggc
gtgatccgctacctgaccttcttccacaactacaatatcctcatcgccacactgcgggtg
gccctgcccagcgtcatgcgcttctgctgctgtgtggctgtcatctacctgggctactgc
ttctgtggctggatcgtgctggggccctatcatgtgaagttccgctcgctctccatggtg
tctgagtgcctgttctcgctcatcaacggggacgacatgttcgtgacgttcgccgccatg
caggcgcagcagggccgcagcagcctggtgtggctcttctcccagctctacctgtactcc
ttcatcagcctcttcatctacatggtgctcagcctcttcatcgcgctcatcaccggcgcc
tacgacaccatcaagcatcccggcggcgcaggcgcagaggagagcgagctgcaggcctac
atcgcacagtgccaggacagccccacctccggcaagttccgccgcgggagcggctcggcc
tgcagccttctctgctgttgcggaagggacccctcggaggagcattcgctgctggtgaat
tga

DBGET integrated database retrieval system