KEGG   Pan paniscus (bonobo): 100976010
Entry
100976010         CDS       T02283                                 

Gene name
PHKB
Definition
(RefSeq) phosphorylase kinase regulatory subunit beta
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100976010 (PHKB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100976010 (PHKB)
   04922 Glucagon signaling pathway
    100976010 (PHKB)
SSDB
Motif
Pfam: Glyco_hydro_15 KPBB_C
Other DBs
NCBI-GeneID: 100976010
NCBI-ProteinID: XP_003819842
UniProt: A0A2R9B3W5
Position
16
AA seq 1086 aa
MACSPDAVVSPSSAFLRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTLLLYQSPT
TGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIKCMRGILY
CYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLLYLVEMIS
SGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVGLAKAALE
AINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCISYPAFAL
DDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDGIECEFPI
FFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYEKNNPGSQ
KRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVSMRFSNQG
PLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQLGINEKL
GLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKNALQFIKQ
YWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLISGAVVEQ
LDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWKDKPTHEI
LQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWSVVRRAAS
LLSKVVDSLAPSITNVLVQGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCNTHDEREA
VIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLYQLSPSEV
KQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAGKHLPQQP
TLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRL
VKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNND
DPCLIS
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcctgctcacctgatgcagtcgtctctccgtcttccgctttcttaaggtctggctca
gtttatgaacctcttaaaagcattaatcttccaagacctgataatgaaactctctgggat
aagttggaccattattacagaattgtcaagtcaacattgctgctgtatcaaagtccaact
accggtctctttcccactaaaacatgcggtggtgaccagaaggccaagatccaggacagc
ctatactgcgctgctggggcctgggctttggctcttgcatacaggcgaattgatgatgac
aagggaaggacccatgagctggagcactcagctataaaatgcatgagaggaattctctac
tgctatatgcgtcaggccgataaggtccagcagtttaagcaggatccacgcccaacaaca
tgtcttcactctgttttcaatgtgcatacaggagatgagttgctctcctatgaggaatat
ggtcatcttcagataaatgcagtgtcactctatctcctttaccttgtggaaatgatttcc
tcaggacttcagattatctacaacactgatgaggtctcttttattcaaaaccttgtattt
tgtgtggaaagagtttaccgtgtgcctgactttggtgtctgggaaagaggaagcaaatat
aataatggcagcacagagctacattcgagctcggttggtttagcaaaagcagctctagaa
gcaattaatggattcaacctttttggcaaccagggctgttcgtggtcagttatatttgtg
gatctcgatgctcacaatcgcaacaggcaaactttgtgctcgctgttacccagagaatca
agatcacataatacagatgctgccctgctcccctgcatcagttatcctgcatttgccctg
gatgatgaagttctttttagccagacacttgataaagtggttagaaaattaaaaggaaaa
tatggatttaaacgtttcttgagagatgggtatagaacatcattggaagatcccaacaga
tgctactacaagccagctgaaattaagctatttgatggcattgaatgtgaatttcccata
tttttcctttatatgatgattgatggagtttttagaggcaatcctaagcaagtacaggaa
tatcaggatcttttgactccagtacttcatcataccacagaaggatatcctgttgtacca
aagtactattatgtgccagctgactttgtagaatatgaaaaaaataaccctggtagtcaa
aaacgatttcctagcaactgtggccgtgatggaaaactgtttctttggggacaagcactt
tatatcatcgcaaaactcctggctgatgaactaattagtcctaaagacattgatcctgtc
cagcgctatgtcccactaaaggatcaacgtaacgtgagcatgaggttttccaatcagggc
ccactggaaaatgacttggtagttcatgtggcacttatagcagaaagccaaagacttcaa
gtttttctgaacacatatggtattcaaactcaaactcctcaacaagtagaacccattcag
atatggcctcagcaggagcttgtgaaagcttatttgcagctgggtatcaatgaaaagtta
ggactctctggaaggccagacaggcccattggctgcctcggtacatcaaagatttatcgc
attctaggaaagactgtggtttgttacccgattattttcgacctaagtgatttctacatg
tctcaggatgttttcctgctgatagatgacataaagaatgcgctgcagttcattaaacaa
tattggaaaatgcatggacgtccacttttccttgttctcatccgggaagacaatataaga
ggtagccggttcaaccccatattagatatgctggcagcccttaaaaaaggaataattgga
ggagtcaaagttcatgtggatcgtctacagacactaatatctggagctgtagtagaacaa
cttgatttcctacgaatcagtgacacagaagagcttccagaatttaagagttttgaggaa
ctagaacctcccaaacattcaaaagtcaaacggcaaagcagcacccctagtgctcctgaa
ctgggacagcagccggatgtcaacattagtgaatggaaggacaaacccacccacgaaatt
cttcaaaaactgaatgattgcagttgtctggctagccaagccatcctgctgggtatactg
ctcaaaagagaaggccccaacttcatcacaaaggaaggtaccgtttctgatcacattgag
agagtctatagaagagctggcagccaaaaactttggtcggttgtacgccgtgcagcaagt
cttttaagtaaagtagtggacagcctggccccatccattactaatgttttagtgcagggc
aaacaggtaactctgggtgcctttgggcatgaagaagaagttatctctaatcctttgtct
ccaagagtgattcaaaacatcatctattataagtgtaacacccatgatgagagggaagcg
gtcattcagcaagaactggtcatccatattggctggatcatctccaataaccctgagtta
ttcagtggcatgctgaaaataagaatcgggtggatcatccatgccatggagtatgaactt
cagatccgtggcggagacaagccagccttggacttgtatcagctgtcacctagtgaagtt
aaacagcttctgctggatattctgcagcctcaacagaatggaagatgttggctgaacagg
cgtcagatcgatgggtctttgaatagaactcccaccgggttctatgaccgagtgtggcag
attctggagcgcacgcccaatgggatcattgttgctgggaagcatttgcctcagcaacca
accctgtcagatatgaccatgtatgagatgaatttctctctccttgttgaagacacgttg
ggaaatattgaccagccacagtacagacagatcgttgtagagttacttatggttgtatcc
attgtactggaaagaaaccccgagctagaatttcaagacaaagtagatctagacagactg
gtcaaagaagcatttaatgaatttcaaaaagatcagagtcggctaaaggaaattgaaaaa
caagatgacatgacttccttttacaacactcctcccctgggaaaaagaggaacatgcagc
tatttgacaaaggcggtgatgaatctgctgctggaaggagaagtcaagccaaacaatgat
gacccgtgtctgattagctag

KEGG   Pan paniscus (bonobo): 100981775
Entry
100981775         CDS       T02283                                 

Gene name
PHKA2
Definition
(RefSeq) phosphorylase kinase regulatory subunit alpha 2
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100981775 (PHKA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100981775 (PHKA2)
   04922 Glucagon signaling pathway
    100981775 (PHKA2)
SSDB
Motif
Pfam: Glyco_hydro_15 KPBB_C
Other DBs
NCBI-GeneID: 100981775
NCBI-ProteinID: XP_003819590
UniProt: A0A2R9BBG6
Position
X
AA seq 1235 aa
MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMA
YRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTAT
CGTVVGDDQWGHLQVDATSLFLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVAD
YGMWERGDKTNQGIPELNASSVGMAKAALEAIDELDLFGAHGGRKSVIHVLPDEVEHCQS
ILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVSLVNVTKNEIISKLQGRYGCCRFLRDG
YKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQEYREALEGILI
RGKNGIRLVPELYAVPPNKVDEEYKNPHTVDRLPMGKVPHLWGQSLYILSSLLAEGFLAT
GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILS
HIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFTDQHHFYLALDNEMIV
EMLRIELAYLCTCWRMTGRPTLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFGGARVK
LGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYPEDTCNQESQDEL
DHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPT
KVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDRGDVDCEKLVEQLKDCSNLQDQADIL
YILYVIKGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTKLIYEASGQDISIAVLTQEIVVYLAM
YVRAQPSLFVEMLRLRIGLIIQVMATELARSLNCSGEEASESLMNLSPFDMKNLLHHILS
GKEFGVERSVRPIHSSTSSPAISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFSADEQF
FSVGQAASSSAHSSKSARSSTPSSPTGTSSSDSGGHHIGWGERQGQWLRRRRLDGAINRV
PVGFYQRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKFAVHVESVLNRVPQPEYRQLL
VEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEKDQATGICHFF
YDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgcggagcaggagcaattccggggtccgcttggacgggtacgcgcggctggtgcagcaa
accatcctgtgttaccagaatcccgtcacggggctgctgtcagccagccatgagcagaag
gatgcctgggtgcgggataacatctacagtatcctggccgtgtggggcctgggcatggcc
taccgtaagaatgcagaccgcgatgaggacaaggccaaggcctacgagctggagcagaac
gtggtgaagctgatgcgaggtcttctccagtgcatgatgagacaggtggccaaagtggag
aagttcaaacacactcagagcaccaaggacagcctgcacgccaagtacaacactgccacc
tgtggcacggtggtgggcgacgaccagtggggccacctccaggtggatgccacctctctc
ttcctcctgttcctggcccagatgaccgcctcaggcttacgtatcattttcactctcgat
gaggtggccttcatacagaatcttgtcttttacatagaagctgcatataaagtcgctgat
tatggaatgtgggagcgtggagataagactaatcagggcatcccggaattgaatgcaagc
tccgtaggaatggccaaggcagctcttgaggcaattgatgaactggacctttttggagcc
catggaggacgcaagtcagtgattcatgttctgccagatgaggtcgagcactgccagtct
attctgttctccatgctgccaagagcgtcaacatctaaagaaattgatgctggacttctt
tccattatttccttcccggcctttgcagtggaagatgtaagccttgtaaatgtgaccaaa
aatgaaattatttctaagctccaggggcgttatggatgctgtcgcttccttcgagatggt
tataaaactccaagagaggaccctaatcgactgcattatgaccctgctgaactcaagctc
ttcgaaaacattgaatgtgagtggcctgtgttttggacatattttataatagatggagtc
ttcagtggtgatgctgttcaggtccaagaataccgagaggccctggagggaatactcatc
agaggcaagaatgggatccgcctggtgcctgaactctacgctgtcccgcctaacaaggta
gatgaagagtacaagaatcctcacacagtagaccgacttcctatggggaaggtgcctcat
ctgtggggccaatccttgtacatcctcagctcgctgttggcagagggattccttgccact
ggtgaaatcgatcccttaaatagaagattttccacttcagtcaaacctgatgttgtagta
caagttactgttttggcagaaaacaatcacattaaggacttattgaggaaacacggggtg
aacgtccagagtatcgcggacattcatccaattcaagtccagccgggccggattcttagt
cacatatatgccaagcttggacggaataagaatatgaatttgagtgggcgaccatatcga
catattggtgtccttggaacctctaaactatatgtgattaggaaccaaatctttactttt
acaccccagttcaccgaccagcatcacttctacctggccctcgacaatgagatgatcgtg
gagatgctaaggatcgagctggcctacctgtgcacctgctggaggatgacgggcagaccc
acactcaccttccccatcagtcgcaccatgctcacaaatgatggctcagacattcattct
gctgtgctctccacaattagaaaactagaggatggatattttggaggagccagagtaaaa
ttagggaacctttcggaatttctcaccacatcgttctacacatatctgacttttctggat
ccagactgtgatgagaagttgtttgacaatgccagcgaagggactttcagtcctgatagt
gattcagatttggtaggatatccggaagacacctgtaatcaagaaagccaagacgaactt
gaccattatatcaaccaccttctgcaaagcacatcgttgaggtcctatctgcctcctctt
tgtaagaacacagaagaccgccatgtcttcagtgctatccactccacgcgggacatactt
tctgtgatggcaaaagcaaagggtttggaagttccatttgttcccatgactttgccaact
aaagttctaagtgcccaccgtaaatcactgaatcttgttgattctcctcagccactccta
gaaaaggttcctgaaagtgactttcagtggcccagagatgaccgtggtgacgtggactgt
gagaagctggttgagcagctaaaagattgttcgaacctacaggaccaagcagacattctg
tacattctttatgtcataaagggtcccagctgggacacaaatctctctggacagcacggg
gtcaccgttcaaaaccttctcggtgagctctatgggaaagccggcttgaaccaggagtgg
ggtctgattcgctacatctcaggccttctcaggaagaaagtggaggtcctggctgaggcc
tgcacagacctgctttcgcaccagaagcagctcaccgtgggcctgccgcccgagccccgg
gagaagatcatctctgcgccccttcccccagaggagctcacaaaactcatctatgaggcc
agtgggcaggacatcagcattgccgtcctcacgcaggagattgtggtttacctggccatg
tatgtcagggcgcagcccagcctctttgtggagatgctgagactccggattggactgatc
attcaggtgatggccacggagctggcacggagcctgaactgctcaggagaagaggcttct
gaaagtttgatgaacctcagccctttcgatatgaaaaatctcctgcaccatattctaagt
gggaaagagtttggcgttgaaagaagtgtgcgccctatccactcctccacatccagccct
gccatctccatccacgaggtgggccataccggagtcaccaaaactgagaggagtggcatt
aacagactgaggagtgaaatgaaacagatgactaggcggtttagtgctgatgaacagttc
ttttctgtgggccaggccgcgtccagcagtgcgcattcctccaagtctgcgaggtccagc
accccatcctcgcccactggcacgtcatcctcagactcgggaggacatcacatcggctgg
ggtgagcggcagggccagtggctgcgcaggagaaggctggatggggccatcaacagggtc
cccgtgggattctaccagagggtgtggaagatcctccagaagtgccacggtctctccatc
gatggttatgtcctcccatcctcgacgacccgagagatgaccccgcatgagatcaagttt
gctgtccatgtcgaatcggtgctgaatcgcgtgccgcagcccgagtaccggcagctgctg
gtggaagccatcatggtgctgacgctgctctcggacacggagatgaccagcatcgggggc
atcatccacgtggaccagatcgtgcagatggccagtcagctgttcttgcaggaccaggtg
tcaattggcgccatggacaccctggagaaagaccaagccacaggaatctgccacttcttt
tatgacagcgctccgagtggggcttacgggacgatgacctacctaacaagagcagtggct
tcttatttgcaggaattgttgcccaattcgggctgccagatgcaatag

KEGG   Pan paniscus (bonobo): 100983464
Entry
100983464         CDS       T02283                                 

Gene name
PHKG2
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 2
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100983464 (PHKG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100983464 (PHKG2)
   04922 Glucagon signaling pathway
    100983464 (PHKG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100983464 (PHKG2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     100983464 (PHKG2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  PHK family
   100983464 (PHKG2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Pkinase_fungal RIO1 TCAD9 Haspin_kinase YrbL-PhoP_reg Choline_kinase DUF2805 FliG_N Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 100983464
NCBI-ProteinID: XP_003807523
UniProt: A0A2R9B805
Position
16
AA seq 406 aa
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRRLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgacgctggacgtggggccggaggatgagctgcccgactgggccgccgccaaagagttt
taccagaagtacgaccctaaggacgtcatcggcagaggagtgagctctgtggtccgccgt
tgtgttcatcgagctactggccacgagtttgcggtgaagattatggaagtgacagctgag
cggctgagtcctgagcagctggaggaggtgcgggaagccacacggcgagagacacacatc
cttcgccaggtcgccggccacccccacatcatcaccctcatcgattcgtatgagtcttct
agcttcatgttcctggtgtttgacctgatgcggaagggagagctgtttgactatctcaca
gagaaggtggccctctctgaaaaggaaaccaggtccatcatgcggtctctgctggaagca
gtgagctttctccatgccaacaacattgtgcatcgagatctgaagcccgagaatattctc
ctagatgacaatatgcagatccgactttcagatttcgggttctcctgccacttggaacct
ggcgagaagcttcgagagttgtgtgggaccccagggtatctagcgccagagatccttaaa
tgctccatggatgaaacccacccaggctatggcaaggaggtcgacctctgggcctgtggg
gtgatcttgttcacactcctggctggctcgccacccttctggcaccggcggcagatcctg
atgttacgcatgatcatggagggccagtaccagttcagttcccccgagtgggatgaccgt
tccagcactgtcaaagacctgatctccaggctgctgcaggtggatcctgaggcacgcctg
acagctgagcaggccctacagcaccccttctttgagcgttgtgaaggcagccaaccctgg
aacctcaccccccgccagcggttccgggtggcagtgtggacggtgctggctgctggacga
gtggccctaagcacccatcgtgtacggccactaaccaagaatgcactgttgagggaccct
tatgcgctgcggtcagtgcggcgcctcatcgacaactgtgccttccggctctacgggcac
tgggtaaagaaaggggagcagcagaaccgggcggctctctttcagcaccggccccctggg
ccttttcccatcatgggccctgaagaggagggagactctgctgctataactgaggatgag
gccgtgcttgtgctgggctag

KEGG   Pan paniscus (bonobo): 100986631
Entry
100986631         CDS       T02283                                 

Gene name
PHKG1
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 1
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100986631 (PHKG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100986631 (PHKG1)
   04922 Glucagon signaling pathway
    100986631 (PHKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100986631 (PHKG1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     100986631 (PHKG1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  PHK family
   100986631 (PHKG1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Haspin_kinase APH Spc110_C ABC1 FTA2 YrbL-PhoP_reg RIO1 Pkinase_fungal TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 100986631
NCBI-ProteinID: XP_008962058
UniProt: A0A2R9ASX0
Position
7
AA seq 387 aa
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYVVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgacccgggacgaggcactgccggactctcattctgcacaggacttctatgagaattat
gagcccaaagagatcctgggcaggggcgttagcagtgtggtcaggcgatgcatccacaag
cccacgagccaggagtacgccgtgaaggtcatcgacgtcaccggtggaggcagcttcagc
ccggaggaggtgcgggagctgcgagaagccacgctgaaggaggtggacatcctgcgcaag
gtctcggggcaccccaacatcatacagctgaaggacacttatgagaccaacactttcttc
ttcttggtgtttgacctgatgaagagaggggagctctttgactacctcactgagaaggtc
accttgagtgagaaggaaaccagaaagatcatgcgagctctgctggaggtgatctgcacc
ttgcacaaactcaacatcgtgcaccgggacctgaagcccgagaacattctcttggatgac
aacatgaacatcaagctcacagactttggcttttcctgccagctggagccgggagagagg
ctgcgagaggtctgcgggacccccagttacctggcccctgagattatcgagtgctccatg
aatgaggaccacccgggctacgggaaagaggtggacatgtggagcactggcgtcatcatg
tacacgctgctggccggctccccgcccttctggcaccggaagcagatgctgatgctgagg
atgatcatgagcggcaactaccagtttggctcgcctgagtgggatgattactcggacacc
gtgaaggacctggtctcccgattcctggtggtgcaaccccagaaccgctacacagcggaa
gaggccttggcacaccccttcttccagcagtacgtggtggaggaagtgcggcacttcagc
ccccgggggaagttcaaggtgatcgctctgaccgtgctggcttcagtgcggatctactac
cagtaccgccgggtgaagcctgtgacccgggagatcgtcatccgagacccctatgccctc
cggcctctgcgccggctcatcgacgcctacgctttccgaatctatggccactgggtgaag
aaggggcagcagcagaaccgggcagcccttttcgagaacacacccaaggccgtgctcctc
tccctggccgaggaggactactga

KEGG   Pan paniscus (bonobo): 100987241
Entry
100987241         CDS       T02283                                 

Gene name
PHKA1
Definition
(RefSeq) phosphorylase kinase regulatory subunit alpha 1
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100987241 (PHKA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100987241 (PHKA1)
   04922 Glucagon signaling pathway
    100987241 (PHKA1)
SSDB
Motif
Pfam: Glyco_hydro_15 KPBB_C
Other DBs
NCBI-GeneID: 100987241
NCBI-ProteinID: XP_003805299
UniProt: A0A2R9CAS6
Position
X
AA seq 1210 aa
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEINFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYREALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYKEGSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQSPGTSMTPS
SGSFPSAYDHQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQKCHGLSVEGFVLP
SSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEK
IVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTMTYLSKAAATYVQE
FLPHSICAMQ
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgaggagccggagtaactccggggtccggctggacggctacgctcgactggtgcaacag
accatcctgtgccatcagaatccagtgactggcttgcttccagccagctatgatcagaaa
gatgcttgggtccgagataatgtgtacagcatcttggctgtgtggggtttgggcctggcc
tatcggaagaatgcagaccgggatgaggataaggcaaaggcctatgaattggagcagagt
gtagtgaagctgatgagaggactactgcactgcatgatcagacaggtggataaagtagaa
tccttcaaatatagtcagagtactaaggatagcctccatgcaaagtacaacaccaaaacc
tgtgccactgtagtgggtgatgatcaatggggacacctgcagttggatgctacctctgtg
tacctgctcttcttagcccaaatgactgcctcaggactccatatcatccacagcctagat
gaaatcaatttcatacagaaccttgtgttttacattgaagctgcatataaaactgctgac
ttcgggatatgggaacgtggagacaagaccaaccaagggatctcagagttgaatgccagt
tcagttggaatggcaaaggcagccctggaagcattagatgaactggatctgtttggtgtg
aaaggtgggcctcaatcagttatccatgtcctggctgatgaagtacagcactgccagtct
atcctaaattcactactgccccgtgcttcaacatcaaaagaggttgatgctagtctactc
tcagtggtttccttccctgcctttgcagtagaggatagccagttggtggagctcacaaaa
caggaaatcatcaccaagcttcagggtcgttatggttgctgtcgctttctacgagatgga
tataaaactcctaaagaggatcccaatcgtctgtactatgaaccagctgagctgaagcta
tttgaaaacattgagtgtgaatggccattgttctggacatactttattcttgatggggtc
ttcagtggcaatgcagaacaggttcaagaatatagagaggctcttgaagcagtcctcatc
aagggcaaaaatggagtcccacttctgccagagctgtacagtgttcctcctgacagggtc
gatgaagaatatcagaatcctcacactgtggaccgagtccccatggggaaattgcctcac
atgtggggtcagtctctatacattttaggaagcttgatggcagagggatttttagcccct
ggagaaattgatcccctgaatcgcaggttttctactgtaccgaagccagatgttgtggtt
caagtctccattctagctgaaacagaagaaatcaagaccattttgaaggacaagggaatt
tacgtggagaccattgctgaggtataccccatcagagtacaaccagctcgtattctcagc
cacatttattccagcctaggatgcaacaatagaatgaaactcagtggacgaccctacaga
cacatgggagtgcttggaacttcaaaactctatgacattcggaaaactatctttactttc
actccacagtttatagaccagcaacagttctacctggctctggacaacaagatgatagtg
gaaatgcttagaacagacctctcctacctctgtagtcgctggcggatgacaggccagccc
accatcaccttccccatctcacacagcatgcttgatgaagatggaacaagcttgaattca
agtatcctggcagcactccgaaaaatgcaagatggctattttggtggggcaagggttcaa
acaggtaaattgtcagagtttttgacaacatcttgttgcacacacttgagcttcatggac
cctggacctgagggtaagctgtacagtgaagattatgatgacaactacgattacctggaa
tctggcaactggatgaatgattatgattcaaccagtcatgctcgctgtggtgatgaagtt
gctcgttatttagatcatcttttggcgcacactgctccccatcctaaactagcccctacc
tcacagaagggagggctagatcggttccaagctgctgtgcaaacaacctgcgacttaatg
tccttggtaaccaaggccaaggaactgcatgtacagaatgttcacatgtatcttcctacg
aagttatttcaggcttcccggccttcattcaacttacttgattcacctcatccccgacag
gagaaccaggttccctctgttcgtgtagaaatacatcttcctagagaccagtctggggag
gtggactttaaagcactggttttacagttgaaggagacctcaagcttacaggaacaagct
gatatcctctatatgctgtatactatgaaaggacctgactggaacactgaattgtataaa
gaagggagtgctacagtgagagagcttcttaccgagctgtatggcaaagtgggagaaatt
cgtcactggggcctgatccgatacatttctggaatcttaaggaagaaagtggaagcactt
gatgaggcctgcacagaccttctctcccaccagaaacatttgacagtaggacttcctcca
gaacctcgagaaaagactatctctgcacctctgccctatgaggcgctcactcagctgata
gatgaagccagtgaaggggatatgagcatttcaatccttacacaggaaataatggtgtat
ctagccatgtatatgcgaacccagcctggcctctttgctgaaatgtttcgacttcgaatt
ggtctgatcatacaagttatggcaacagaactggcccactcccttcgatgctcagctgag
gaagccacagagggcctgatgaatctcagtccttcagccatgaagaatctcctgcatcac
attctcagcggcaaggagtttggagtggaacgaagcgttcgtcccactgattcaaatgtc
agtcctgctatttctatccatgagattggtgctgttggagcaaccaaaacagaacgaact
gggatcatgcagttaaaaagtgagataaagcagtcacctggaacctctatgactccaagt
agtgggtcctttcctagtgcatatgatcaccagtcatctaaagatagtcgtcaaggtcaa
tggcaacgccgaagaaggctggatggggcactgaatagagttccagttggattttatcag
aaagtatggaaagttttgcagaagtgtcacggactttctgttgaagggtttgtccttcct
tcttctaccactagagagatgactccaggtgagattaaattctctgttcatgtggagtct
gtcctgaatcgtgtacctcagccagagtaccgccagctgctggttgaagccatccttgtc
ctcaccatgctggcagatattgaaattcatagcatcggaagcatcattgctgtggaaaaa
atagtgcatattgccaatgacttgttccttcaagaacagaaaacccttggcgcagatgat
accatgttggcaaaggatcccgcatctggcatctgtactcttctgtatgacagtgcaccc
agtggcaggtttggcaccatgacctacctctccaaggcagccgccacctacgtgcaggag
ttcctgccccacagcatctgtgccatgcaatga

DBGET integrated database retrieval system