KEGG   Pan paniscus (bonobo): 100976112
Entry
100976112         CDS       T02283                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04071  Sphingolipid signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04722  Neurotrophin signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04972  Pancreatic secretion
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05415  Diabetic cardiomyopathy
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100976112 (RAC1)
   04014 Ras signaling pathway
    100976112 (RAC1)
   04015 Rap1 signaling pathway
    100976112 (RAC1)
   04310 Wnt signaling pathway
    100976112 (RAC1)
   04370 VEGF signaling pathway
    100976112 (RAC1)
   04071 Sphingolipid signaling pathway
    100976112 (RAC1)
   04024 cAMP signaling pathway
    100976112 (RAC1)
   04151 PI3K-Akt signaling pathway
    100976112 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100976112 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100976112 (RAC1)
   04520 Adherens junction
    100976112 (RAC1)
   04530 Tight junction
    100976112 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100976112 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100976112 (RAC1)
   04620 Toll-like receptor signaling pathway
    100976112 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    100976112 (RAC1)
   04662 B cell receptor signaling pathway
    100976112 (RAC1)
   04664 Fc epsilon RI signaling pathway
    100976112 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    100976112 (RAC1)
   04670 Leukocyte transendothelial migration
    100976112 (RAC1)
   04062 Chemokine signaling pathway
    100976112 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100976112 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100976112 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    100976112 (RAC1)
   04380 Osteoclast differentiation
    100976112 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100976112 (RAC1)
   05205 Proteoglycans in cancer
    100976112 (RAC1)
   05203 Viral carcinogenesis
    100976112 (RAC1)
   05231 Choline metabolism in cancer
    100976112 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100976112 (RAC1)
   05212 Pancreatic cancer
    100976112 (RAC1)
   05211 Renal cell carcinoma
    100976112 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100976112 (RAC1)
   05163 Human cytomegalovirus infection
    100976112 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100976112 (RAC1)
   05169 Epstein-Barr virus infection
    100976112 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100976112 (RAC1)
   05135 Yersinia infection
    100976112 (RAC1)
   05100 Bacterial invasion of epithelial cells
    100976112 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100976112 (RAC1)
   05020 Prion disease
    100976112 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100976112 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100976112 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    100976112 (RAC1)
   05415 Diabetic cardiomyopathy
    100976112 (RAC1)
   05416 Viral myocarditis
    100976112 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100976112 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100976112 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100976112 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100976112 (RAC1)
   04031 GTP-binding proteins [BR:pps04031]
    100976112 (RAC1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100976112 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100976112 (RAC1)
  Macropinocytosis
   Ras GTPases
    100976112 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100976112 (RAC1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100976112 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   100976112 (RAC1)
  Exosomal proteins of colorectal cancer cells
   100976112 (RAC1)
  Exosomal proteins of bladder cancer cells
   100976112 (RAC1)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100976112 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf 40S_SA_C CagD Protamine_like
Other DBs
NCBI-GeneID: 100976112
NCBI-ProteinID: XP_008956668
Position
7
AA seq 293 aa
MQVPSVPIQQFPAEDWSSHPAREDWSAAPTAQAAEWAVGLGLCRGAGAAGGRPQRTLTAR
AARAWFRLSMEEGLAARRLEGKVNSTLRLSSRTPPAALLGSARSSPHVLNKKRAVGKTCL
LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITY
PQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcaggtgccctctgtgcctatccagcagttccctgctgaagactggagcagtcatcct
gccagggaagactggtctgcggctcccactgctcaggctgctgaatgggcggtgggcctg
ggcctgtgtcgcggggcgggggccgcgggcgggcgcccccaacggaccctgacggcccgg
gcggcgcgtgcctggttccggctctcgatggaggagggcctcgccgctcgccggctagag
ggaaaagtgaactccaccctccggctttcttcccggacgccgcctgccgccctcctcggg
agcgctcgatctagtccccatgtccttaacaagaagagagctgtaggtaaaacttgccta
ctgatcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaat
tattctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagct
ggacaagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttctta
atttgcttttcccttgtgagtcctgcatcatttgaaaacgtccgtgcaaagtggtatcct
gaggtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatctt
agggatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctat
ccgcagggtctagccatggctaaggagattggtgctgtaaaatatctggagtgctcggcg
ctcacacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgccca
cctcccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Pan paniscus (bonobo): 100989777
Entry
100989777         CDS       T02283                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04071  Sphingolipid signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04722  Neurotrophin signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04972  Pancreatic secretion
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05415  Diabetic cardiomyopathy
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100989777
   04014 Ras signaling pathway
    100989777
   04015 Rap1 signaling pathway
    100989777
   04310 Wnt signaling pathway
    100989777
   04370 VEGF signaling pathway
    100989777
   04071 Sphingolipid signaling pathway
    100989777
   04024 cAMP signaling pathway
    100989777
   04151 PI3K-Akt signaling pathway
    100989777
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100989777
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100989777
   04520 Adherens junction
    100989777
   04530 Tight junction
    100989777
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100989777
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100989777
   04620 Toll-like receptor signaling pathway
    100989777
   04650 Natural killer cell mediated cytotoxicity
    100989777
   04662 B cell receptor signaling pathway
    100989777
   04664 Fc epsilon RI signaling pathway
    100989777
   04666 Fc gamma R-mediated phagocytosis
    100989777
   04670 Leukocyte transendothelial migration
    100989777
   04062 Chemokine signaling pathway
    100989777
  09154 Digestive system
   04972 Pancreatic secretion
    100989777
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100989777
  09158 Development and regeneration
   04360 Axon guidance
    100989777
   04380 Osteoclast differentiation
    100989777
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100989777
   05205 Proteoglycans in cancer
    100989777
   05203 Viral carcinogenesis
    100989777
   05231 Choline metabolism in cancer
    100989777
  09162 Cancer: specific types
   05210 Colorectal cancer
    100989777
   05212 Pancreatic cancer
    100989777
   05211 Renal cell carcinoma
    100989777
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100989777
   05163 Human cytomegalovirus infection
    100989777
   05167 Kaposi sarcoma-associated herpesvirus infection
    100989777
   05169 Epstein-Barr virus infection
    100989777
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100989777
   05135 Yersinia infection
    100989777
   05100 Bacterial invasion of epithelial cells
    100989777
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100989777
   05020 Prion disease
    100989777
   05022 Pathways of neurodegeneration - multiple diseases
    100989777
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100989777
   05418 Fluid shear stress and atherosclerosis
    100989777
   05415 Diabetic cardiomyopathy
    100989777
   05416 Viral myocarditis
    100989777
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100989777
   04933 AGE-RAGE signaling pathway in diabetic complications
    100989777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100989777
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100989777
   04031 GTP-binding proteins [BR:pps04031]
    100989777
Membrane trafficking [BR:pps04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100989777
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100989777
  Macropinocytosis
   Ras GTPases
    100989777
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100989777
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100989777
  Exosomal proteins of other body fluids (saliva and urine)
   100989777
  Exosomal proteins of colorectal cancer cells
   100989777
  Exosomal proteins of bladder cancer cells
   100989777
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100989777
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 100989777
NCBI-ProteinID: XP_008962197
Position
6
AA seq 261 aa
MYRQFSSALGGGRCRASASSPRRARRRGQRPRHPAPRRPQAARPSAAPRARRFLSQRPAA
AAAAQRAALMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPV
NLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPII
LVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDE
AIRAVLCPPPVKKRKRKCLLL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtaccggcagttttcctcagctttgggtggtggccgctgccgggcatcggcttccagt
ccgcggagggcgaggcggcgtggacagcggccccggcacccagcgccccgccgcccgcaa
gccgcgcgcccgtccgccgcgccccgagcccgccgcttcctatctcagcgccctgccgcc
gccgccgcggcccagcgagcggccctgatgcaggccatcaagtgtgtggtggtgggagac
ggagctgtaggtaaaacttgcctactgatcagttacacaaccaatgcatttcctggagaa
tatatccctactgtctttgacaattattctgccaatgttatggtagatggaaaaccggtg
aatctgggcttatgggatacagctggacaagaagattatgacagattacgccccctatcc
tatccgcaaacagatgtgttcttaatttgcttttcccttgtgagtcctgcatcatttgaa
aatgtccgtgcaaagtggtatcctgaggtgcggcaccactgtcccaacactcccatcatc
ctagtgggaactaaacttgatcttagggatgataaagacacgatcgagaaactgaaggag
aagaagctgactcccatcacctatccgcagggtctagccatggctaaggagattggtgct
gtaaaatatctggagtgctcggcgctcacacagcgaggcctcaagacagtgtttgacgaa
gcgatccgagcagtcctctgcccacctcccgtgaagaagaggaagagaaaatgcctgctg
ttgtaa

DBGET integrated database retrieval system