KEGG   Pan paniscus (bonobo): 100977040
Entry
100977040         CDS       T02283                                 

Gene name
ASPH
Definition
(RefSeq) aspartate beta-hydroxylase
  KO
K00476  aspartate beta-hydroxylase [EC:1.14.11.16]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100977040 (ASPH)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100977040 (ASPH)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.16  peptide-aspartate beta-dioxygenase
     100977040 (ASPH)
SSDB
Motif
Pfam: Asp_Arg_Hydrox Asp-B-Hydro_N TPR_16 TPR_14 TPR_2 TPR_6 TPR_11 TPR_19 TPR_8 YfiO SNAP ATG27 ANAPC3 DUF2299
Other DBs
NCBI-GeneID: 100977040
NCBI-ProteinID: XP_003805152
UniProt: A0A2R9BAX9
Position
8
AA seq 729 aa
MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGI
YDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKE
QIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETE
HSYHVEETISQDYNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPP
ENEGIEITEVTAPPEDNPVEDSQVIVEEVSVFPVEEQQEVPPETNRKTDDPEQKAKVKKR
KPKLLNKFDKTIKAELDAAEKLRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLA
EKRRSNEVLRGAIETYQEVASLPDVPADLLKLSLKRRSDRQQFLGHMRGSLLTLQRLVQL
FPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFAKVHYGFILKAQNKIAESIP
YLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNG
LKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAVMDKAKGLFLPEDENLRERGDWSQFT
LWQQGRRNENACKGAPKTCTLLEKFPETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRM
HLGLVIPKEGCKIRCANETKTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTP
QQRRSLPAI
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggctgaagataaagagacaaagcatggaggacacaagaacgggaggaaaggcggactc
tcaggaacttcattcttcacgtggtttatggtgattgcattgctgggcgtctggacgtct
gtagctgtcgtttggtttgatcttgttgactatgaggaagttctaggaaaactaggaatc
tatgatgctgatggtgatggagattttgatgtggatgatgccaaagttttattaggactt
aaagagagatctacttcagagccagcagtcccgccagaagaggctgagccacacactgag
cccgaggagcaggttcctgtggaggcagaaccccagaatatcgaagatgaagcaaaagaa
caaattcagtcccttctccatgaaatggtacacgcagaacatgttgaaggagaagacttg
caacaagaagatggacccacaggagaaccacaacaagaggatgatgagtttcttatggcg
actgatgtagatgatagatttgagaccctggaacctgaagtatctcatgaagaaaccgag
catagttaccacgtggaagagacaatttcacaagactataatcaggatatggaagagatg
atgtctgagcaggaaaatccagattccagtgaaccagtagtagaagatgaaagattgcac
catgatacagatgatgtaacataccaagtctatgaggaacaagcagtatatgaacctcca
gaaaatgaagggatagaaatcacagaagtaactgctccccctgaggataatcctgtagaa
gattcacaggtaattgtagaagaagtaagcgtttttcctgtggaagaacaacaggaagta
ccaccagaaacaaatagaaaaacagatgatccagaacaaaaagcaaaagttaagaaaagg
aagcctaaacttttaaataaatttgataagactattaaagctgaacttgatgctgcagaa
aaactccgtaaaaggggaaaaattgaggaagcagtgaatgcatttaaagaactagtacgc
aaataccctcagagtccacgagcaagatatgggaaggcgcagtgtgaggatgatttggct
gagaagaggagaagtaatgaggtgctacgtggagccatcgagacctaccaagaggtggcc
agcctacctgatgtccctgcagacctgctgaagctgagtttgaagcgtcgctcagacagg
caacaatttctaggtcatatgagaggttccctgcttaccctgcagagattagttcaacta
tttcccaatgatacttccttaaaaaatgaccttggcgtgggatacctcttgataggagat
aatgacaatgcaaagaaagtttatgaagaggtgctgagtgtgacacctaatgatggcttt
gccaaagtccattatggcttcatcctgaaggcacagaacaaaattgctgagagcatccca
tatttaaaggaaggaatagaatctggagatcctggcactgatgatgggagattttatttc
cacctgggggatgccatgcagagggttgggaacaaagaggcatataagtggtatgagctt
gggcacaagagaggacactttgcatctgtctggcaacgctcactctacaatgtgaatgga
ctgaaagcacagccttggtggaccccaaaagaaacgggctacacagagttagtaaagtct
ttagaaagaaactggaagttaatccgagatgaaggccttgcagtgatggataaagccaaa
ggtctcttcctgcctgaggatgaaaacctgagggaaagaggggactggagccagttcacg
ctgtggcagcaaggaagaagaaatgaaaatgcctgcaaaggagctcctaaaacctgtacc
ttactagaaaagttccccgagacaacaggatgcagaagaggacagatcaaatattccatc
atgcaccccgggactcacgtgtggccgcacacagggcccacaaactgcaggctccgaatg
cacctgggcttggtgattcccaaggaaggctgcaagattcgatgtgccaacgagaccaag
acctgggaggaaggcaaggtgctcatctttgatgactcctttgagcacgaggtatggcag
gatgcctcatctttccggctgatattcatcgtggatgtgtggcatccggaactgacacca
cagcagagacgcagccttccagcaatttag

DBGET integrated database retrieval system