KEGG   Pan paniscus (bonobo): 100977227
Entry
100977227         CDS       T02283                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05219  Bladder cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100977227 (ERBB2)
   04012 ErbB signaling pathway
    100977227 (ERBB2)
   04066 HIF-1 signaling pathway
    100977227 (ERBB2)
   04020 Calcium signaling pathway
    100977227 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100977227 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100977227 (ERBB2)
   04520 Adherens junction
    100977227 (ERBB2)
   04530 Tight junction
    100977227 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100977227 (ERBB2)
   05206 MicroRNAs in cancer
    100977227 (ERBB2)
   05205 Proteoglycans in cancer
    100977227 (ERBB2)
   05230 Central carbon metabolism in cancer
    100977227 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100977227 (ERBB2)
   05226 Gastric cancer
    100977227 (ERBB2)
   05219 Bladder cancer
    100977227 (ERBB2)
   05215 Prostate cancer
    100977227 (ERBB2)
   05213 Endometrial cancer
    100977227 (ERBB2)
   05224 Breast cancer
    100977227 (ERBB2)
   05223 Non-small cell lung cancer
    100977227 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100977227 (ERBB2)
   01524 Platinum drug resistance
    100977227 (ERBB2)
   01522 Endocrine resistance
    100977227 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100977227 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100977227 (ERBB2)
   04090 CD molecules [BR:pps04090]
    100977227 (ERBB2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100977227 (ERBB2)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100977227 (ERBB2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100977227 (ERBB2)
CD molecules [BR:pps04090]
 Proteins
  100977227 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100977227
NCBI-ProteinID: XP_003831500
UniProt: A0A2R9C656
Position
17
AA seq 1255 aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLP
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDVGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQ
GGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagttggcggccttgtgccgctgggggctcctcctcgccctcttgccccccggagcc
gcgagcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcctgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggaaacctg
gaactcacctacctgcccaccaatgccagcctgtccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctagacaatgga
gacccgctgaacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtgttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgccacccctgttctccgatgtgtaag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacgtttgag
tccatgcccaatcccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtctgccccctgcacaaccaa
gaggtgacagcagaggatggaacacagcggtgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcagttaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttctgccggagagc
tttgatggggacccagcctccaacactgccccgctccagccagagcagctccaagtgttt
gagactctggaagagatcacaggttacctatacatctcagcatggccagacagcctgcct
gacctcagcgtcttccagaacctgcaagtaatccggggacgaattctacacaatggcgcc
tactcgctgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgagggaa
ctgggcagtggactggccctcatccaccataacacccacctctgcttcgtgcacacggtg
ccctgggaccagctctttcggaacccgcaccaagctctgctccacactgccaaccggcca
gaggatgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccaggcactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgttttggaccggag
gctgaccagtgtgtggcctgtgcccactataaggaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacatgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgcggtggttggc
attctgctggtcgtggtcttgggggtggtctttgggatcctcatcaagcgacggcagcag
aagatccggaagtacacgatgcggagactgctgcaggaaacggagctggtggagccgctg
acacctagcggagcgatgcccaaccaggcgcagatgcggatcctgaaggagacggagctg
aggaaggtgaaggtgcttggatctggcgcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttagacgaagcatacgtgatggctggtgtgggctcccca
tatgtctcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgggaaaaccgcggacgcctgggctcccag
gacctgctgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagacttcgggctggctcggctgctggacattgatgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaaaggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtctgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcaccttctaccgctcactgctggaggacgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgccccgggcgctggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgaca
ctagggctggagccctctgaagaggaggcccccaggtctccactggcaccctccgaaggg
gctggctccgatgtatttgatggtgacgtgggaatgggggcagccaaggggctgcaaagc
ctccccacacatgaccccagccctctacagcggtacagtgaggaccccacagtacccctg
ccctctgagactgatggctacgttgcccccctgacctgcagcccccagcccgaatatgtg
aaccagccagatgttcggccccagcccccttcgccccgagagggccctctgcctgctgcc
cgacctgctggtgccactctggaaaggcccaagactctctccccagggaagaatggggtc
gtcaaagacgtttttgcctttgggggtgccgtggagaaccccgagtacttgacaccccag
ggaggagctgcccctcagccccaccctcctcctgccttcagcccagccttcgacaacctc
tattactgggaccaggacccaccagagcggggggctccacccagcaccttcaaagggaca
cctacggcagagaacccagagtacctgggtctggacgtgccagtgtga

DBGET integrated database retrieval system