KEGG   Pan paniscus (bonobo): 100977890
Entry
100977890         CDS       T02283                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00600  Sphingolipid metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps05152  Tuberculosis
Module
pps_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100977890 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100977890 (SPHK1)
   04371 Apelin signaling pathway
    100977890 (SPHK1)
   04020 Calcium signaling pathway
    100977890 (SPHK1)
   04072 Phospholipase D signaling pathway
    100977890 (SPHK1)
   04071 Sphingolipid signaling pathway
    100977890 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100977890 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100977890 (SPHK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100977890 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 100977890
NCBI-ProteinID: XP_003813286
UniProt: A0A2R8ZTA2
Position
17
AA seq 384 aa
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQTPPPEEPL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatccagcgggcggcccccggggcgtgctcccgcggccctgccgcgtgctggtgctg
ctgaacccgcgcggcggcaagggcaaggccttgcagctcttccggagtcacgtgcagccc
cttttggctgaggctgaaatctccttcacgctgatgctcactgagcggcggaaccacgcg
cgggagctggtgcggtcggaggagctgggccgctgggacgctctggtggtcatgtctgga
gacgggctgatgcacgaggtggtgaacgggctcatggagcggcctgactgggagaccgcc
atccagaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttccttg
aaccattatgctggttatgagcaggtcaccaatgaagacctcctgaccaactgcacgcta
ttgctgtgccgccggctgctgtcgcccatgaacctgctgtctctgcacacggcttcgggg
ctgcgcctcttctctgtgctcagcctggcctggggcttcattgctgatgtggacctagag
agtgagaagtatcggcgtctgggggagatgcgcttcactctgggcaccttcctgcgtctg
gcagccctgcgcacctaccgtggccgactggcctacctccctgtaggaagagtcggttcc
aagacacctgcctcccccgttgtggtccagcagggcccggtagatgcacaccttgtgcca
ctggaggagccagtgccctctcactggacagtggtgcccgacgaggactttgtgctagtc
ctggcactgctgcactcgcacctgggcagtgagatgtttgctgcacccatgggccgctgt
gcagctggcgtcatgcatctgttctacgtgcgggcgggagtgtctcgcgccatgctgctg
cgcctcttcctggccatggagaagggcaggcatatggagtatgaatgcccctacttggta
tatgtgcccgtggtcgccttccgcttggagcccaaggatgggaaaggtgtgtttgcagtg
gatggggaattgatggttagcgaggccgtgcagggccaggtgcacccaaactacttctgg
atggtcagtggttgcgtggagcccccgcccagctggaagccccagcagacgccaccgcca
gaagagcccttatga

KEGG   Pan paniscus (bonobo): 100992056
Entry
100992056         CDS       T02283                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00600  Sphingolipid metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps05152  Tuberculosis
Module
pps_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100992056 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100992056 (SPHK2)
   04371 Apelin signaling pathway
    100992056 (SPHK2)
   04020 Calcium signaling pathway
    100992056 (SPHK2)
   04072 Phospholipase D signaling pathway
    100992056 (SPHK2)
   04071 Sphingolipid signaling pathway
    100992056 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100992056 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100992056 (SPHK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100992056 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 100992056
NCBI-ProteinID: XP_003814128
UniProt: A0A2R9B1L3
Position
19
AA seq 654 aa
MNGHLETEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
QGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagcaggaccagaggccagaccaggagctgacc
gggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
caaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccccggttgcttctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggctggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacccgcctcgcccacccctgcccatagcctgcctcgtgccaagtcggag
ctgaccctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctcttcccctgccccagcctgccctggcctctcctggctcgccagaaccc
ctgcccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggct
ggggatgctccgctgtccccggacccactgctgtcttcacctcctggctctcccaaggca
gctctacactcacccgtctccgaaggggcccccgtaattcccccatcctctgggctccca
cttcccacccctgatgcccgggtaggggcctccacctgcggcccgcccgaccacctgctg
cctccgctgggcaccccgctgcccccagactgggtgacgctggagggggactttgtgctc
atgttggccatctcgcccagccacctaggcgctgacctggtggcagctccgcatgcgcgc
ttcgacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgctg
ctgcgccttttcttggccatggagcgtggtagccacttcagcctgggctgtccgcagctg
ggctacgccgcggcccgtgccttccgcctagagccgctcacaccacgcggcgtgctcaca
gtggacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcatcggt
acactgctcactgggcctcctggctgcccggggcgggagccctga

DBGET integrated database retrieval system