KEGG   Pan paniscus (bonobo): 100979248
Entry
100979248         CDS       T02283                                 

Gene name
ATP2A2
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04919  Thyroid hormone signaling pathway
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100979248 (ATP2A2)
   04024 cAMP signaling pathway
    100979248 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    100979248 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100979248 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100979248 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    100979248 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    100979248 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100979248 (ATP2A2)
   05017 Spinocerebellar ataxia
    100979248 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    100979248 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100979248 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100979248 (ATP2A2)
   05414 Dilated cardiomyopathy
    100979248 (ATP2A2)
   05415 Diabetic cardiomyopathy
    100979248 (ATP2A2)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100979248 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 100979248
NCBI-ProteinID: XP_008956152
Position
12
AA seq 917 aa
MGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESV
SVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQE
RTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVA
AIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCR
MFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVKCHQYDGLVELATICALCNDSAL
DYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTL
EFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIM
SVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIE
VASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQ
RDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAV
AKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEA
LIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGA
ATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVT
IEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQ
WLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVLLIMPL
VIWVYSTDTNFSDMFWS
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgggcaaagtgtatcgacaggacagaaagagtgtacagcggattaaagctaaagacata
gttcctggtgatattgtagaaattgctgttggtgacaaagttcctgctgatataaggtta
acttctatcaaatctaccacactaagagttgaccagtcaattctcacaggtgaatctgtc
tctgtcatcaagcacactgatcccgtccctgacccacgagctgtcaaccaagataaaaag
aacatgctgttttctggtacaaacattgctgctgggaaagctatgggagtggtggtagca
actggagttaacaccgaaattggcaagatccgggatgaaatggtggcaacagaacaggag
agaacaccccttcagcaaaaactagatgaatttggggaacagctttccaaagtcatctcc
cttatttgcattgcagtctggatcataaatattgggcacttcaatgacccggttcatgga
gggtcctggatcagaggtgctatttactactttaaaattgcagtggccctggctgtagca
gccattcctgaaggtctgcctgcagtcatcaccacctgcctggctcttggaactcgcaga
atggcaaagaaaaatgccattgttcgaagcctcccgtctgtggaaacccttggttgtact
tctgttatctgctcggacaagactggtacacttacaacaaaccagatgtcagtctgcagg
atgttcattctggacagagtggaaggtgatacttgttcccttaatgagtttaccataact
ggatcaacttatgcacctattggagaagtgcataaagatgataaaccagtgaaatgtcac
cagtatgatggtctggtagaattagcaacaatttgtgctctttgtaatgactctgctttg
gattacaatgaggcaaagggtgtgtatgaaaaagttggagaagctacagagactgctctc
acttgcctagtagagaagatgaatgtatttgataccgaattgaagggtctttctaaaata
gaacgtgcaaatgcctgcaactcagtcattaaacagctgatgaaaaaggaattcactcta
gagttttcacgtgacagaaagtcaatgtcggtttactgtacaccaaataaaccaagcagg
acatcaatgagcaagatgtttgtgaagggtgctcctgaaggtgtcattgacaggtgcacc
cacattcgagttggaagtactaaggttcctatgacctctggagtcaaacagaagatcatg
tctgtcattcgagagtggggtagtggcagcgacacactgcgatgcctggccctggccact
catgacaacccactgagaagagaagaaatgcaccttgaggactctgccaactttattaaa
tatgagaccaatctgaccttcgttggctgcgtgggcatgctggatcctccgagaatcgag
gtggcctcctccgtgaagctgtgccggcaagcaggcatccgggtcatcatgatcactggg
gacaacaagggcactgctgtggccatctgtcgccgcatcggcatcttcgggcaggatgag
gacgtgacgtcaaaagctttcacaggccgggagtttgatgaactcaacccctccgcccag
cgagacgcctgcctgaacgcccgctgttttgctcgagttgaaccctcccacaagtctaaa
atcgtagaatttcttcagtcttttgatgagattacagctatgactggcgatggcgtgaac
gatgctcctgctctgaagaaagccgagattggcattgctatgggctctggcactgcggtg
gctaaaaccgcctctgagatggtcctggcagatgacaacttctccacgattgtggctgcc
gttgaggaggggcgggcaatctacaacaacatgaaacagttcatccgctacctcatctcg
tccaacgtcggggaagttgtctgtattttcctgacagcagcccttggatttcccgaggct
ttgattcctgttcagctgctctgggtcaatctggtgacagatggcctgcctgccactgca
ctggggttcaaccctcctgatctggacatcatgaataaacctccccggaacccaaaggaa
ccattgatcagcgggtggctctttttccgttacttggctattggctgttacgtcggcgct
gctaccgtgggtgctgctgcatggtggttcattgctgctgacggtggtccaagagtgtcc
ttctaccagctgagtcatttcctacagtgtaaagaggacaacccggactttgaaggcgtg
gattgtgcaatctttgaatccccatacccgatgacaatggcgctctctgttctagtaact
atagaaatgtgtaacgccctcaacagcttgtccgaaaaccagtccttgctgaggatgccc
ccctgggagaacatctggctcgtgggctccatctgcctgtccatgtcactccacttcctg
atcctctatgtcgaacccttgccactcatcttccagatcacaccgctgaacgtgacccag
tggctgatggtgctgaaaatctccttgcccgtgattctcatggacgagacgctcaagttt
gtggcccgcaactacctggaacctggtaaagagtgtgtgcagcctgccaccaaatcctgc
tcgttctcggcatgcaccgatgggatttcctggccgtttgtgctgctcataatgcccctg
gtgatctgggtctatagcacagacactaactttagcgatatgttctggtcttga

KEGG   Pan paniscus (bonobo): 100987290
Entry
100987290         CDS       T02283                                 

Gene name
ATP2A3
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04919  Thyroid hormone signaling pathway
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100987290 (ATP2A3)
   04024 cAMP signaling pathway
    100987290 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    100987290 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100987290 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100987290 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    100987290 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    100987290 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100987290 (ATP2A3)
   05017 Spinocerebellar ataxia
    100987290 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    100987290 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100987290 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100987290 (ATP2A3)
   05414 Dilated cardiomyopathy
    100987290 (ATP2A3)
   05415 Diabetic cardiomyopathy
    100987290 (ATP2A3)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100987290 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Hydrolase_3 Cation_ATPase_N HAD DUF3106
Other DBs
NCBI-GeneID: 100987290
NCBI-ProteinID: XP_008960835
Position
17
AA seq 961 aa
MTSFSPLRKSLWELVLEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFMEPLVIMLIL
VANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDK
VPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGK
AVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGH
FADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPS
VETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEADAGSSLLHEFTISGTTYTPEGEVRQG
DQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTD
LQALSRVERAGACNTVIKQLMRKEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAP
ESVIERCSSVRVGSRTAPLSPASREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMEL
DDCSKFVQYEMDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRR
LGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEIT
AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMK
QFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME
KLPRSPREALISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSE
DNPLFAGIDCEVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLAAVA
MSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILLDEALKYLSRNHTHEEKSQ
K
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgacttccttctccccgctgaggaagtccctgtgggagctggtgctggaacagtttgag
gacctcctggtgcgcatcctgctgctggctgcccttgtctcctttgtcctggcctggttc
gaggagggcgaggagaccacgaccgccttcatggagcccctggtcatcatgctgatcctc
gtggccaacgccattgtgggcgtgtggcaggaacgcaacgccgagagtgccatcgaggcc
ctgaaggagtatgagcctgagatgggcaaggtgatccgctcggaccgcaagggcgtgcag
aggatccgtgcccgggacatcgtcccaggagacattgtagaagtggcagtgggggacaaa
gtgcctgctgacctccgcctcatcgagatcaagtccaccacgctgcgagtggaccagtcc
atcctgacgggtgaatctgtgtccgtgaccaagcacacagaggccatcccagaccccaga
gctgtgaaccaggacaagaagaacatgctgttttctggcaccaatatcacatcgggcaaa
gcggtgggtgtggccgtggccaccggcctgcacacggagctgggcaagatccggagccag
atggcggcagtcgagcccgagcggacgccgctgcagcgcaagctggacgagtttggacgg
cagctgtcccacgccatctctgtgatctgcgtggccgtgtgggtcatcaacatcggccac
ttcgccgacccggcccacggtggctcctggctgcgcggcgctgtctactacttcaagatc
gccgtggccctggcggtggcggccatccccgagggcctcccggctgtcatcactacatgc
ctggcactgggcacgcggcgcatggcacgcaagaacgccatcgtgcgaagcctgccgtcc
gtggagaccctgggctgcacctcagtcatctgctccgacaagacgggcacgctcaccacc
aatcagatgtctgtctgccggatgttcgtggtagccgaggccgatgcgggctccagcctt
ttgcacgagttcaccatctcgggtaccacgtatacccccgagggcgaagtgcggcagggg
gatcagcctgtgcgctgcggccagttcgacgggctggtggagctggcgaccatctgcgcc
ctgtgcaacgactcggcgctggactacaacgaggccaagggtgtgtacgagaaggtggga
gaggccacggagacagctctgacttgcctggtggagaagatgaacgtgttcgacaccgac
ctgcaggctctgtcccgggtggagcgagctggcgcctgtaacacggtcatcaagcagctg
atgcggaaggagttcaccctggagttctcccgagaccggaagtccatgtccgtgtactgc
acgcccacccgccctcaccctaccggccagggcagcaagatgtttgtgaagggggctcct
gagagtgtgatcgagcgctgcagctcagtccgcgtggggagccgcacagcacccctgagc
cccgcctccagggagcagatcctggcaaagatccgggattggggctcaggctcagacacg
ctgcgctgcctggcactggccacccgggacgcgcccccaaggaaggaggacatggagctg
gacgactgcagcaagtttgtgcagtacgagatggacctgaccttcgtgggctgcgtaggc
atgctggacccgccgcgacctgaggtggctgcctgcatcacacgctgctaccaggcgggc
atccgcgtggtcatgatcacgggggataacaaaggcactgccgtggccatctgccgcagg
cttggcatctttggggacacggaagacgtggcgggcaaggcctacacgggccgcgagttt
gatgacctcagccccgagcagcagcgccaggcctgccgcaccgcccgctgctttgcccgc
gtggagcccgcacacaagtcccgcatcgtggagaacctgcagtcctttaacgagatcact
gccatgactggcgatggagtgaacgacgcaccagccctgaagaaagcagagatcggcatc
gccatgggctcaggcacggccgtggccaagtcggcggcagagatggtgctgtcagatgac
aactttgcctccatcgtggctgcggtggaggagggccgggccatctacagcaacatgaag
caattcatccgctacctcatctcctccaatgttggcgaggtcgtctgcatcttcctcacg
gcaattctgggcctgcccgaagccctgatccctgtgcagctgctctgggtgaacctggtg
acagacggcctacctgccacggctctgggcttcaacccgccagacctggacatcatggag
aagctgccccggagcccccgagaagccctcatcagtggctggctcttcttccgatacctg
gctatcggagtgtacgtaggcctggcgacagtggctgccgccacctggtggtttgtgtat
gacgccgagggacctcacatcaacttctaccagctgaggaacttcctgaagtgctctgaa
gacaacccgctctttgccggcatcgactgtgaggtgttcgagtcacgcttccccaccacc
atggccttgtccgtgctcgtgaccattgaaatgtgcaatgccctcaacagcgtctcggag
aaccagtcgctgctgcggatgccgccctggatgaacccctggctgctggcggctgtggcc
atgtccatggccctgcacttcctcatcctgctcgtgccgcccctgcctctcattttccag
gtgaccccactgagcgggcgccagtgggtggtggtgctccagatatctctgcctgtcatc
ctgctggatgaggccctcaagtacctgtcccggaaccacacgcacgaagaaaagagccag
aagtga

KEGG   Pan paniscus (bonobo): 100993633
Entry
100993633         CDS       T02283                                 

Gene name
ATP2A1
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04919  Thyroid hormone signaling pathway
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100993633 (ATP2A1)
   04024 cAMP signaling pathway
    100993633 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    100993633 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100993633 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100993633 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    100993633 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    100993633 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100993633 (ATP2A1)
   05017 Spinocerebellar ataxia
    100993633 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    100993633 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100993633 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100993633 (ATP2A1)
   05414 Dilated cardiomyopathy
    100993633 (ATP2A1)
   05415 Diabetic cardiomyopathy
    100993633 (ATP2A1)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100993633 (ATP2A1)
SSDB
Motif
Pfam: Cation_ATPase_C Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 100993633
NCBI-ProteinID: XP_008976948
Position
16
AA seq 636 aa
MFIIDKVDGDICFLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSL
DFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTL
EFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKI
MAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRK
EVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAE
QREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTA
VAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPE
ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVG
AATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLV
TIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLT
QWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgtttatcattgacaaggtggatggggacatctgcttcctgaatgagttctccatcacc
ggctccacttacgctccagagggagaggtcttgaagaatgataagccagtccggccaggg
cagtatgacgggctggtggagctggccaccatctgtgccctctgcaatgactcctccttg
gacttcaacgaggccaaaggtgtctatgagaaggtcggcgaggccaccgagacggcactc
accaccctggtggagaagatgaatgtgttcaacacggatgtgagaagcctctcgaaggtg
gagagagccaatgcctgcaactcggtgatccgccagctaatgaagaaggaattcaccctg
gagttctcccgagacagaaagtccatgtctgtctattgctccccagccaaatcttcccgg
gctgctgtgggcaacaagatgtttgtcaagggtgcccctgagggcgtcatcgaccgctgt
aactatgtgcgagttggcaccacccgggtgccactgacggggccggtgaaggaaaagatc
atggcggtgatcaaggagtggggcactggccgggacaccctgcgctgcttggccctggcc
acccgggacacccccccgaagcgagaggaaatggtcctggatgactctgccaggttcctg
gagtatgagacggacctgacattcgtgggtgtagtgggcatgctggaccctccacgcaag
gaggtcacgggctccatccagctgtgccgtgacgccgggatccgggtgatcatgatcact
ggggacaacaagggcacagccattgccatctgccggcgaattggcatctttggggagaac
gaggaggtggccgatcgcgcctacacgggccgagagttcgacgacctgcccctggctgaa
cagcgggaagcctgccgacgtgcctgctgcttcgcccgcgtggagccctcgcacaagtcc
aagattgtggagtacctgcagtcctacgatgaaatcacagccatgacaggtgatggtgtt
aatgacgcccctgccctgaagaaggccgagattggcattgccatgggatctggcactgcc
gtggccaagactgcctctgagatggtgctggctgacgacaacttctccaccattgtagct
gctgtggaggagggccgcgccatctacaacaacatgaagcagttcatccgctacctcatt
tcctccaacgtgggcgaggtggtctgtatcttcctgaccgctgccctggggctgcctgag
gccctgatcccggtgcagctgctgtgggtgaacttggtgactgacgggctcccagccaca
gccctgggcttcaacccaccagacctggacatcatggaccgccccccccggagccccaag
gagcccctcatcagtggctggctcttcttccgctacatggcaatcgggggctatgtgggt
gcagccaccgtgggagcagctgcctggtggttcctgtacgctgaggatggacctcatgtc
aactacagccagctgactcacttcatgcagtgcaccgaggacaacacccactttgagggc
atagactgtgaggtcttcgaggcccccgagcccatgaccatggccctgtccgtgctggtg
accatcgagatgtgcaatgcactgaacagcctgtccgagaaccagtccctgctgcggatg
ccaccctgggtgaacatctggctgctgggctccatctgcctctccatgtccctgcacttc
ctcatcctctatgttgaccccctgccgatgatcttcaagctccgggccctggacctcacc
cagtggctcatggtcctcaagatctcactgccagtcattgggctcgacgaaatcctcaag
ttcgttgctcggaactacctagaggatccagaagatgaaagaaggaagtga

DBGET integrated database retrieval system