KEGG   Pan paniscus (bonobo): 100979742
Entry
100979742         CDS       T02283                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04062  Chemokine signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04725  Cholinergic synapse
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05200  Pathways in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979742 (JAK2)
   04151 PI3K-Akt signaling pathway
    100979742 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100979742 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100979742 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100979742 (JAK2)
   04659 Th17 cell differentiation
    100979742 (JAK2)
   04062 Chemokine signaling pathway
    100979742 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100979742 (JAK2)
   04917 Prolactin signaling pathway
    100979742 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    100979742 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    100979742 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100979742 (JAK2)
   05207 Chemical carcinogenesis - receptor activation
    100979742 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100979742 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100979742 (JAK2)
   05164 Influenza A
    100979742 (JAK2)
   05168 Herpes simplex virus 1 infection
    100979742 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979742 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100979742 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979742 (JAK2)
   05140 Leishmaniasis
    100979742 (JAK2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100979742 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100979742 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100979742 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979742 (JAK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100979742 (JAK2)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100979742 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo ABC1 Kinase-like RIO1
Other DBs
NCBI-GeneID: 100979742
NCBI-ProteinID: XP_003823415
UniProt: A0A2R8ZHT5
Position
9
AA seq 1132 aa
MGMACLTMTEMEGTSASSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEVCSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcctgccttacgatgacagaaatggagggaacatccgcctcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagttcttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatccggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtactgcagtggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaacgatcaaaccccactggccatc
tataactctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcaattc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccaaccgtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttttgacatttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaagattttt
aaaggcgtacgaagagaagtaggagactacggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagtatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagat
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtatgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaagtggagttttggc
accactttgtgggaagtctgcagtggaggagataaacctctaagtgctctggattctcaa
agaaagctacaattttatgaagataggcatcagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctagggttttctggtgcctttgaagaccgggat
cctacacagtttgaagagagacatttgaaatttctgcagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtcgct
gtaaaaaagcttcagcatagtactgaagagcacctaagagactttgaaagggaaattgaa
atcctgaaatccctacaacatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacataaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgaga
aatatattggtggagaatgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgtatgattggcaacgacaaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatctatatg
atcatgacagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagct
cttcgagtggatcaaataagggataacatggctggatga

DBGET integrated database retrieval system