KEGG   Pan paniscus (bonobo): 100980378
Entry
100980378         CDS       T02283                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04114  Oocyte meiosis
pps04210  Apoptosis
pps04218  Cellular senescence
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100980378 (ITPR2)
   04020 Calcium signaling pathway
    100980378 (ITPR2)
   04070 Phosphatidylinositol signaling system
    100980378 (ITPR2)
   04022 cGMP-PKG signaling pathway
    100980378 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100980378 (ITPR2)
   04210 Apoptosis
    100980378 (ITPR2)
   04218 Cellular senescence
    100980378 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100980378 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100980378 (ITPR2)
   04621 NOD-like receptor signaling pathway
    100980378 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    100980378 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100980378 (ITPR2)
   04929 GnRH secretion
    100980378 (ITPR2)
   04912 GnRH signaling pathway
    100980378 (ITPR2)
   04915 Estrogen signaling pathway
    100980378 (ITPR2)
   04921 Oxytocin signaling pathway
    100980378 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    100980378 (ITPR2)
   04918 Thyroid hormone synthesis
    100980378 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    100980378 (ITPR2)
   04924 Renin secretion
    100980378 (ITPR2)
   04925 Aldosterone synthesis and secretion
    100980378 (ITPR2)
   04927 Cortisol synthesis and secretion
    100980378 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100980378 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    100980378 (ITPR2)
   04971 Gastric acid secretion
    100980378 (ITPR2)
   04972 Pancreatic secretion
    100980378 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100980378 (ITPR2)
   04725 Cholinergic synapse
    100980378 (ITPR2)
   04728 Dopaminergic synapse
    100980378 (ITPR2)
   04726 Serotonergic synapse
    100980378 (ITPR2)
   04720 Long-term potentiation
    100980378 (ITPR2)
   04730 Long-term depression
    100980378 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    100980378 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100980378 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100980378 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100980378 (ITPR2)
   05163 Human cytomegalovirus infection
    100980378 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100980378 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100980378 (ITPR2)
   05012 Parkinson disease
    100980378 (ITPR2)
   05017 Spinocerebellar ataxia
    100980378 (ITPR2)
   05020 Prion disease
    100980378 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    100980378 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100980378 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100980378 (ITPR2)
Ion channels [BR:pps04040]
 Ligand-gated channels
  IP3 receptor
   100980378 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 100980378
NCBI-ProteinID: XP_003828957
Position
12
AA seq 2697 aa
MSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMN
RYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLL
HIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVL
MPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVVRLFH
AEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFR
FKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHGNDIA
SLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKE
DKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFFVA
DVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQ
RYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNNRK
LLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNADI
LIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADL
EVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLMLH
MHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEYLKE
VVNQPFPFGDKXKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYF
ERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSMPDVPPSIHPSKQGSPTEHEDV
TVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLPSAIV
PDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLFKHF
SQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEIGES
QVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQ
RLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHLSLFL
TPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYV
KKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELLAA
CTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYTS
NHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTSLQT
HQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVNTLFM
KSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPMMQAE
FSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEK
KDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSD
IQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQKKSE
KFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLKEGMK
GQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPILRF
LQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVAL
VNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNA
SKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVSPKDV
GHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYAKHTAQIEIVRHDRTMEQIVFP
VPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSR
HISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKP
VGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDM
AFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALI
LVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPAS
NTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYDLLF
YFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIK
SEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQN
EIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH
NT seq 8094 nt   +upstreamnt  +downstreamnt
atgtccagcttcctctacataggggacatcgtgtccctgtacgcggagggctcggtcaac
ggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcacccagaggccggg
gaccttgccaaccctcccaagaagttcagagactgccttttcaaggtgtgccctatgaac
agatattctgcccagaagcaatattggaaagcaaagcaagccaaacaagggaaccacacc
gaggcagccttgctgaagaaactacagcacgctgcagaactggaacaaaaacaaaatgaa
tcagagaataagaaactgttgggagaaattgtaaaatacagtaatgttatacaactactg
catataaaaagcaacaaatatcttactgtcaacaagagattacctgctttactggagaag
aatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttggttttatattcat
ccgttctggaaactgagaagcgagggtgacaatattgttgtaggagataaagttgttttg
atgcctgtgaatgcagggcagccactacatgccagcaacatagagcttcttgataaccca
gggtgtaaagaggtgaatgctgttaattgcaacaccagctggaaaatcactttattcatg
aaatatagttcctatcgagaggatgtattaaaaggaggggacgttgttagattatttcat
gcggaacaagagaagtttttgacttgtgatgaatatgagaaaaaacagcacattttcctt
cgtacgaccttgcgccaatcagctacttctgctactagttctaaagcactctgggaaata
gaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaacagcttgttcaga
tttaagcatcttgcaactggaaactatttagctgcagagcttaatcctgattatcgagat
gcccaaaatgaaggaaaaaatgtgagagatggagtccctccaacttcaaagaaaaaacgc
caggcaggggagaagatcatgtatactttggtttcagtcccgcatggcaatgacattgca
tccctttttgaactagatgccacaactcttcagagagctgactgcctggttccaaggaac
tcatatgttcggttaaggcatttatgcaccaacacatgggtaaccagtactagtatcccc
atagacacagatgaagagaggcctgttatgttaaagattggaacctgccaaaccaaagaa
gataaagaagcgttcgcaatcgtgtctgttccactgtctgaagttcgagacttagacttt
gctaatgatgccaataaagtactagcgaccacagttaaaaagctagaaaacggcacaata
actcagaatgaaaggaggtttgtaaccaaattattggaagatctcatattctttgttgct
gatgtgcctaataatggacaagaagttctggatgtggttatcactaagccaaaccgagag
cgtcaaaaattgatgagggaacaaaacatactggcacaggtatttggaattcttaaagca
ccctttaaagagaaagcaggagaaggctcgatgctgagacttgaagatctgggggatcaa
agatatgcaccctacaagtacatgctacggctctgttaccgcgtcctgagacactcgcag
caggattaccggaaaaatcaggaatatattgctaagaatttctgtgtcatgcagtcccag
attggctatgatattttggcagaagatactatcacagctttgttgcacaacaacagaaaa
ctactagagaaacatatcacagcaaaagaaatagaaacatttgtcagtttactcaggaga
aatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtctaataccaccgct
atccctgtaactcaagaactcatctgtaaatttatgttgagtccaggcaatgcagacatt
ctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggagagctccatcctt
tcggatgacattgatgatgaagaagtttggctctattggattgacagcaacaaggaacct
catggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcaccaaagctgactta
gaagttcttacctattacaggtaccagctaaacctctttgcaaggatgtgcttggatcgc
cagtatctggccataaaccagatttctacacagctgtctgtagacctgatcctgcggtgt
gtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgcctcatgctccac
atgcacgttgaccgggatccccaggagtccgtggtgcctgttcgctatgccaggctctgg
acagaaatccccacaaagatcacaattcatgaatatgattctataacagactcttccaga
aatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaatatttgaaagaa
gttgtaaaccagccctttccttttggggataaangaaaaaataaactgacatttgaggtg
gtccacttggctcggaatcttatatactttggattttatagtttcagtgagttattaagg
ctaacaagaacacttctggctattttagacattgtacaggcccccatgtcatcatacttt
gaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaaccattcatggggtg
ggagagatgatgacccagatggtactcagtagaggctccatcttccccatgagcatgccg
gatgtgccacccagcatccacccgagcaagcaagggagccccaccgagcacgaggatgtg
actgtgatggacaccaagctgaagatcattgagattttgcagtttatcctgagtgtcaga
ctggattataggatctcatatatgctgtcaatatataagaaggagtttggagaggacaat
gacaatgcggagacatctgccagtggatctccagacactttactaccatcagctattgtt
cctgatatagatgaaattgcagctcaggcagaaactatgtttgcgggaagaaaggaaaaa
aatccagttcaacttgacgatgaaggaggcaggacgtttttacgggtcctcattcatctg
atcatgcacgactacccgcctttgctgtctggagccctgcagctgttgtttaagcacttc
agccagagggcggaggttttacaggcatttaagcaggtgcaattacttgtgtctaatcaa
gacgtagataactacaagcaaatcaaggcagatctagaccagcttcgactgacagtagaa
aagtctgagctatgggtggagaagagcagcaactatgagaatggagaaataggggaaagt
caagtgaaaggtggtgaagagccaattgaggaatcgaacattttaagtccagtgcaggat
ggaacaaagaaacctcagattgacagcaacaagagcaataactaccggattgtaaaggag
attttgatcaggctaagtaaactctgtgtacagaataaaaagtgtcggaatcaacatcaa
cgattactgaaaaatatgggggcgcattcggtggtgttggatcttctgcagataccctat
gaaaagaatgacgaaaagatgaatgaagtaatgaatctagcccatacatttctgcagaat
ttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctgagtttgttttta
actccaggtctccttgaagcagaaaccatgcggcacatcttcatgaacaattaccatctg
tgcaacgaaattagcgagagagttgtacagcactttgtgcactgcattgagacacatggc
cgccacgtggagtacctgaggtttttgcaaacaattgtaaaagcagatggtaaatatgtg
aagaaatgccaggatatggtaatgacagagttgataaatgggggtgaagacgtgctgata
ttttacaatgatagagcatcatttccaatccttctccatatgatgtgttcagagagagac
cgaggggatgagagtggccccttagcctaccacatcaccctggtggagttgctggcagca
tgcacagaggggaaaaatgtctacactgaaatcaagtgtaattcccttctcccgctggac
gacatagtgagggtggtgacccatgatgactgcatccctgaggttaaaattgcttatgtg
aactttgttaatcactgttatgttgacactgaagtggaaatgaaagaaatctatacaagt
aaccacatttggaaattatttgagaacttcttggtggatatggcaagggtttgcaacaca
actacagacaggaaacatgcagacatctttttggaaaagtgtgttactgagtcaataatg
aatattgtgagcggcttctttaattctcccttttcagacaatagtaccagcctccagaca
catcagccagtttttattcagctactgcaatctgccttcagaatttacaattgcacctgg
ccaaacccagcgcagaaagcctcagtggaatcctgtatcagaactttggctgaagtggca
aaaaatcgtggaattgccattccagtggatttggacagccaagttaatactcttttcatg
aagagccattcaaatatggtgcagagagcagcaatgggttggagactatcagctcgctct
gggccacgctttaaggaagctcttggagggcctgcttgggattacagaaatattattgaa
aagttacaggatgtagtggcctccttggagcaccagttcagcccaatgatgcaggctgaa
ttctcagtgttggttgatgtattgtacagtccagaactgctgttccctgagggaagcgat
gcaagaataagatgtggcgctttcatgtcgaagttgattaatcatacaaagaaactaatg
gagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaaatgttagagaag
aaagacagctttgtggaagagggtaacacattaagaaagatacttctgaatcgatacttt
aaaggtgattatagtattggtgtgaatggacacctatcaggggcctactccaaaactgca
caggtgggaggaagcttttctggacaagattcagataagatggggatatcaatgtcagac
attcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgatgttatagtgaac
accaaaaatgacagaattttttcagaaggcattttcctcggcattgccttgcttgaagga
ggaaatacacaaacacagtattctttctaccagcagttgcatgaacaaaaaaagtcagaa
aaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaaataagatcaaca
gtgacagttaataccatagatttaggtaacaaaaaaagggacgatgacaatgaattgatg
acatctggtccacgaatgagagtaagagattcaacactacatttaaaagaaggaatgaaa
gggcaattaacagaagcttcttcagcaacatccaaagcatattgtgtatacagaagagaa
atggatccagaaatagacattatgtgcacaggaccagaagcgggaaacactgaggaaaaa
tccgcagaggaagtaacaatgagtcccgcaattgccatcatgcagccaatactgagattt
cttcagttactgtgtgagaatcacaaccgggaattgcagaacttcttgaggaatcaaaac
aacaaaacaaattacaacctagtctgtgagacccttcagtttctggactgcatttgtgga
agtacaaccggtggcctgggcctgttgggtctctacatcaatgagaagaatgtagcactg
gtcaaccagaccctggagagcttgactgagtattgccagggcccttgccatgaaaatcag
acctgtattgctacacatgaatctaatgggattgatatcatcattgctttgattctgaat
gacataaaccctcttggtaaataccgaatggacctggtgctccagctaaagaacaatgca
tctaaacttttgctggccattatggaaagcagacatgacagtgagaatgcagaaagaatt
ctttttaacatgagacccagagaactggtggatgtgatgaagaatgcctataaccaagga
ttggaatgtgaccatggggatgatgagggtggagatgatggtgtttctccaaaagatgtt
ggacacaatatctatattctggcccatcagttggcccgccacaataaactattgcagcag
atgctcaaaccaggatcagatccagatgaaggagatgaagccttaaaatattatgccaag
cacactgcacagattgagattgtccggcatgataggaccatggaacaaatagtttttcct
gtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtgttcaatacaact
gaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaacagaagatctctac
aatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttctggttctcgagg
cacatctctctctgggggagcatttccttcaacctggctgtgttcatcaatttagctgtt
gctctcttctacccatttggggatgatggagatgaaggtacactttctccattgttctcg
gttcttctttggatagcagttgcgatctgcacatctatgctgtttttcttctccaagcct
gtgggtattcggccgtttcttgtatcaataatgctcagatcaatatatacaataggtctt
gggcctacattaatacttcttggtgcagctaatctttgtaataaaattgtttttctggtg
agttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtcatcctggatatg
gcctttctctatcacgtggcatatgtcctggtttgcatgctgggcctttttgtccatgaa
ttcttctatagcttcctgctttttgatttggtgtacagagaagagactttgctgaatgtc
ataaaaagtgtcacacgaaatggccgctctattattctaactgcagtcctggctctcatc
ctcgtctacctgttttccattattgggttcctttttttgaaggatgacttcactatggaa
gttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtgcctactatgact
ttaactaccatgatggaagcatgtgccaaggagaactgttcacccacaattccagcttcc
aatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgacactctccttatg
tgcattgtcactgtgctgaaccagggcctcaggaatggcggtggtgtgggggacgtgcta
agaaggccatcgaaagatgagcccttgtttgctgcccgagtggtttatgaccttcttttt
tatttcattgttatcattattgttctgaacttgatttttggtgttatcatcgatactttt
gctgatctcagaagcgaaaaacagaaaaaagaagaaattctaaagacaacttgtttcatc
tgtggactcgagagagacaagtttgataataaaacggtttcatttgaggagcacattaag
tcagaacacaatatgtggcattatttatacttcatagtcctggtgaaagttaaagaccca
acagaatacactggacctgaaagttatgtggctcaaatgattgtggagaagaatttggat
tggtttcctcggatgcgagccatgtccctcgttagcaatgaaggcgacagtgagcaaaat
gaaattcggagccttcaggagaagttggaatcgaccatgagtctggtcaaacagctgtcg
ggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaataagcagagactg
ggcttcctcggatcaaacacaccccatgtgaatcatcacatgccaccacactga

KEGG   Pan paniscus (bonobo): 100982024
Entry
100982024         CDS       T02283                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04114  Oocyte meiosis
pps04210  Apoptosis
pps04218  Cellular senescence
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100982024 (ITPR3)
   04020 Calcium signaling pathway
    100982024 (ITPR3)
   04070 Phosphatidylinositol signaling system
    100982024 (ITPR3)
   04022 cGMP-PKG signaling pathway
    100982024 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100982024 (ITPR3)
   04210 Apoptosis
    100982024 (ITPR3)
   04218 Cellular senescence
    100982024 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100982024 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100982024 (ITPR3)
   04621 NOD-like receptor signaling pathway
    100982024 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    100982024 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    100982024 (ITPR3)
   04922 Glucagon signaling pathway
    100982024 (ITPR3)
   04929 GnRH secretion
    100982024 (ITPR3)
   04912 GnRH signaling pathway
    100982024 (ITPR3)
   04915 Estrogen signaling pathway
    100982024 (ITPR3)
   04921 Oxytocin signaling pathway
    100982024 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    100982024 (ITPR3)
   04918 Thyroid hormone synthesis
    100982024 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    100982024 (ITPR3)
   04924 Renin secretion
    100982024 (ITPR3)
   04925 Aldosterone synthesis and secretion
    100982024 (ITPR3)
   04927 Cortisol synthesis and secretion
    100982024 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100982024 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    100982024 (ITPR3)
   04971 Gastric acid secretion
    100982024 (ITPR3)
   04972 Pancreatic secretion
    100982024 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100982024 (ITPR3)
   04725 Cholinergic synapse
    100982024 (ITPR3)
   04728 Dopaminergic synapse
    100982024 (ITPR3)
   04726 Serotonergic synapse
    100982024 (ITPR3)
   04720 Long-term potentiation
    100982024 (ITPR3)
   04730 Long-term depression
    100982024 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    100982024 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    100982024 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    100982024 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100982024 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100982024 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100982024 (ITPR3)
   05163 Human cytomegalovirus infection
    100982024 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982024 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100982024 (ITPR3)
   05012 Parkinson disease
    100982024 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    100982024 (ITPR3)
   05017 Spinocerebellar ataxia
    100982024 (ITPR3)
   05020 Prion disease
    100982024 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100982024 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100982024 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100982024 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100982024 (ITPR3)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100982024 (ITPR3)
Ion channels [BR:pps04040]
 Ligand-gated channels
  IP3 receptor
   100982024 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100982024
NCBI-ProteinID: XP_003808605
UniProt: A0A2R9C081
Position
6
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDTSDPKAAGMGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASFMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKLELDRLRTMVEKSELWVDKKGSGKGEEVE
AGATKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWML
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPLDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSHYSLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAESISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGVSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcggccggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcagctcagaagcagtactggaaggccaagcagactaagcaggac
aaggagaagatcgctgacgtggtgttgctgcagaagctgcagcatgcggcgcagatggag
cagaagcaaaacgacacggagaacaagaaggtgcatggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacagtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgactctggatgccacaggcaacgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcctctgcatgccagcaattacgag
ctcagcgacaatgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagtttcgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccatgcggagcaggagaagttcctgacgtgtgacgagtacaagggcaag
ctgcaggtgttcctgcgaaccacactgcgccagtctgccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggctacaggcaactacctggctgctgaggagaac
cccagttacaaaggtgatacctcagatcccaaggcagcaggaatgggggcacagggccgc
gcaggccgcaggaatgctggggagaagatcaagtaccgcctggtggctgtgcctcatggc
aatgacatcgcctctctctttgagctggaccccaccaccttgcagaaaaccgactctttc
gtgccccggaactcgtacgtccggctgcggcacctctgcaccaacacgtggattcagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcccgtgtctgagatccga
gacctggactttgccaatgacgccagcttcatgctggccagtgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagcgatgtccccaacaatgggcagaatgtcctggacatcatggtcactaag
cccaaccgggaacggcagaagctcatgagggagcagaacatcctcaaacagatctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaacgccccctaccagcacatgtttcgcctgtgctaccgcgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacattgccaagcagtttgggatg
atgcagtcccagattggctacgacatcctggccgaggacaccatcactgccctgctgcac
aacaaccgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaagagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccggaccgagcttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacgtggactgacaagaat
aacgagcatcatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtatcagctgaaactctttgcccgcatgtgc
ttggaccgccagtacttggccatagatgagatctcccagcagctgggcgtggacctgatt
ttcctgtgcatggcagacgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctgcacgtgcacgtggaccgtgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggtggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcagtgcccccagc
ctgtctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatatcctacctgctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagtggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtagggaag
acaagcagcatgctggaggtggacgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagttggagctggaccggctacggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggtgaggaggtggag
gcaggcgccaccaaggacaagaaagagcgtcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagatcgtcaagggcatcctggaaaggctgaac
aagatgtgcggggttggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggtgatgccaag
atgatggagatcctgcgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctacacaagcacctgcacctcttcctcacgccggggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctccgagatcagcgag
cctgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacctg
gacttcctgcacaccgtcattaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgataaggca
tcgctggcccacctgctggacatgatgaaggctgcccgcgacggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggccgcctgtgccgaaggcaaaaac
gtctacactgagatcaagtgcacctctctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcactgaggtgaaaatggcctatgtgaacttcgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggatgctc
ttcgagaacttcaccctggacatggctcgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccttggagaagtacgtgctgagcgttgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtctaccacacgcctcctcgagtgtccgtggctacagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatcttgttg
cccttggacctggatgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtacaggctgagctgtccgtgctggtggatgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccataggcactggcctggacccagactggtcggca
atcgcggccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaacgagaagatcttccaggagagcatcggcctggccatccacctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgcgag
ccagtcgaccccaccacaaaaggccgcgtggcctccttctcgatacctggctcctcatcc
cactattcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
agtgagatgggcacatccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgtgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgtgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaacgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacttgcattgtg
actcatgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcatgacagtgaaaatgctgagcgaatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccataacatctatatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggccgagagtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccagcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cccggcatctgccagttcctgacagaggaaaccaagcaccggctcttcaccactactgag
caggatgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccttacatggagggtgcgtccacaggcgtgctggactcccctctcatctca
ttgctcttctggatcctcatctgcttctccatcgcggccctgttcaccaagcgctacagc
atccgccccctcatcgtggcgcttatcctgcgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccaacaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcaggggtctcggtgcctgag
gtcctggaagaggacagggagctggacagcacagagcgggcctgtgacactctgttgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggcgtgggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcccgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcattgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattcttaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacagtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtgctggtccgcgtgaagaacaag
accgactacacgggccctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaat
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaatgagctcaaggagcagatgacggagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcattagccgctga

KEGG   Pan paniscus (bonobo): 100984884
Entry
100984884         CDS       T02283                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04210  Apoptosis
pps04218  Cellular senescence
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05205  Proteoglycans in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100984884 (ITPR1)
   04020 Calcium signaling pathway
    100984884 (ITPR1)
   04070 Phosphatidylinositol signaling system
    100984884 (ITPR1)
   04022 cGMP-PKG signaling pathway
    100984884 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100984884 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100984884 (ITPR1)
   04210 Apoptosis
    100984884 (ITPR1)
   04218 Cellular senescence
    100984884 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100984884 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100984884 (ITPR1)
   04621 NOD-like receptor signaling pathway
    100984884 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    100984884 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100984884 (ITPR1)
   04929 GnRH secretion
    100984884 (ITPR1)
   04912 GnRH signaling pathway
    100984884 (ITPR1)
   04915 Estrogen signaling pathway
    100984884 (ITPR1)
   04921 Oxytocin signaling pathway
    100984884 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    100984884 (ITPR1)
   04918 Thyroid hormone synthesis
    100984884 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100984884 (ITPR1)
   04924 Renin secretion
    100984884 (ITPR1)
   04925 Aldosterone synthesis and secretion
    100984884 (ITPR1)
   04927 Cortisol synthesis and secretion
    100984884 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100984884 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    100984884 (ITPR1)
   04971 Gastric acid secretion
    100984884 (ITPR1)
   04972 Pancreatic secretion
    100984884 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100984884 (ITPR1)
   04725 Cholinergic synapse
    100984884 (ITPR1)
   04728 Dopaminergic synapse
    100984884 (ITPR1)
   04726 Serotonergic synapse
    100984884 (ITPR1)
   04720 Long-term potentiation
    100984884 (ITPR1)
   04730 Long-term depression
    100984884 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    100984884 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100984884 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100984884 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100984884 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100984884 (ITPR1)
   05163 Human cytomegalovirus infection
    100984884 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984884 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100984884 (ITPR1)
   05012 Parkinson disease
    100984884 (ITPR1)
   05016 Huntington disease
    100984884 (ITPR1)
   05017 Spinocerebellar ataxia
    100984884 (ITPR1)
   05020 Prion disease
    100984884 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    100984884 (ITPR1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100984884 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100984884 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100984884 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100984884 (ITPR1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100984884 (ITPR1)
Ion channels [BR:pps04040]
 Ligand-gated channels
  IP3 receptor
   100984884 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100984884
NCBI-ProteinID: XP_008954853
Position
3
AA seq 2770 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEQELEPSPPLRQLEDHK
RGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSMSRGEMS
LAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDK
KSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEE
VRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKTKDDLEMSAVITIMQPILR
FLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVA
LINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNN
ASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRN
VGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFP
VPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCAR
NMSFWSSISFNLAVLMNLLVAFFYPFKGVRGALPFEGFQKGRGTLEPHWSGLLWTAMLIS
LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT
RGYRAMVLDVEFLYHLLYLVICAMGLFFHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS
IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVE
SGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE
PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK
FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA
MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP
HMNVNPQQPA
NT seq 8313 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctgtttaagcta
tgtcccatgaaccgctactctgctcaaaagcagttctggaaagccgctaagcctggggcc
aacagcacaacagacgcagtgctactcaacaaactgcaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcccgct
ctgttggagaagaatgccatgcgagtcacgttggacgaggctggaaacgaaggctcctgg
ttttacattcagccattctacaagctgcgatccatcggcgacagcgtggtcataggtgac
aaggtggttctgaaccccgtcaatgctggtcagcctctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
catgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgatccatgtcggggcggagcagggtactggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtagaccctgatcaggacgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtatactccctggtctctgtacctgaa
ggcaatgacatctcctccatttttgagctagaccccaccactctccgtggaggtgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaggaagaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttccagtttctcctgctgaagtt
cgggatctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagcta
gagaagggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctagaagatttg
gtttacttcgtcactggtggaactaattctggtcaagatgttctcgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatattctcaagcagatcttc
aagctgttacaagccccattcacagactgcggtgatggcccaatgcttcggctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggctgaagacactatcactgccctgctccac
aataatcggaaactgctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctgtccgacctctgtgtctcc
atgaacaaatcaattccagtgacccaggagctgatatgtaaagctgtgctgaaccccacc
aacgctgacatcttgattgagaccaagttggttctttctcgttttgaatttgaaggtgtt
tcttccactggagagaatgccctggaggcaggagaagacgaggaagaagtgtggctgttt
tggcgggacagcaacaaggagattcgcagcaagagcgtgagggaattggctcaggatgct
aaagaagggcagaaggaggaccgagacgttctcagctactacagatatcagctgaacctc
tttgcgaggatgtgtctggaccgccaatacctggccatcaacgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggcg
tccttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcggagattccctcggagatcgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgctcagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaggagaag
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtacat
gtgacaacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgagatctattcatggcgtgggggagctg
atgacccaggtggtgctccggggaggaggctttttgcccatgactcccatggctgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatcatggtcatggacacc
aagctgaagatcattgagatactccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagaa
acatcctccggaaacagcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagaacaagcagaaggcatctttggaggaagtgaggagaacaccccgctg
gacttggatgaccacggcggcagaacctttctccgggtcttgctccacttgacgatgcat
gactacccacccctggtgtcaggggccctgcagctcctcttccggcacttcagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtggac
aactacaaacagatcaaacaagacttggatcaactgaggtccatcgtggaaaagtcagag
ctttgggtgtacaaagggcagggccccgatgagactatggatggtgcatctggagaaaat
gaacataagaagacggaggagggaaataacaagccacaaaagcatgaaagcaccagcagc
tacaactacagagtggtcaaagagattttgattcggcttagcaaactctgtgttcaagag
agtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctccggaacatgggcgcg
cacgccgtggtgctggagctgctgcagattccctatgagaaggccgaagataccaagatg
caagagataatgaggctggctcatgaatttttgcagaatttctgtgcaggcaaccagcag
aatcaagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggcg
gtaaccatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaacgagaga
gttgttcagcacttcgttcactgcatagagactcacggtcggaatgtccagtatataaag
ttcttacagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggtt
atggccgagctggtcaattcgggagaggatgtccttgtgttctacaacgacagagcctct
ttccagactctgatccagatgatgcggtcagagcgggatcggatggatgagaacagccct
ctcatgtaccacatccacttggtcgagctcctggctgtgtgcacggagggtaagaacgtc
tacacagagatcaagtgcaactccctgctcccgctggatgacatcgttcgcgtggtgacc
cacgaggactgcatccctgaggttaaaattgcatacattaacttcctgaatcactgctat
gtggatacagaggtggaaatgaaggagatttataccagcaatcacatgtggaaattgttt
gagaatttccttgtagacatctgcagggcctgtaacaacactagtgacaggaaacatgca
gactctattttggagaagtatgtcaccgaaatcgtcatgagtattgttactactttcttc
agctctcccttctcagaccagagtacgactttgcagactcgccaacctgtctttgtgcaa
ctgctgcaaggcgtgttcagggtttaccactgcaactggttaatgccaagccaaaaagcc
tccgtggagagctgtattcgggtgctgtctgatgtagccaagagccgggccattgccatt
cccgtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcag
aagacagccatgaactggcggctctcagcccgcaatgccgcacgcagggactctgttctg
gcagcttccagagactaccggaatatcattgagagattgcaggacatcgtctccgcgctg
gaggaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccac
agacccgagctgcttttcccagagaacacagacgccagaaggaaatgtgaaagtggcggt
ttcatttgcaagttaataaagcatacaaaacagctgctagaagaaaatgaagagaagctc
tgcattaaggtcctacagaccctgagggaaatgatgaccaaagatagaggctatggagaa
aagctaatttccattgatgaattggataatgctgagcttcctccagctccagattctgag
aacgccaccgagcaggagcttgaaccaagtccacccctgcggcagctggaagaccataaa
aggggtgaggcgctcaggcaaattctggtcaaccgttactatggaaacatcagaccttcg
ggaagaagagagagccttaccagctttggcaatggcccactgtcaccaggaggaccgagc
aagcccgggggaggagggggaggttccggatccagctctatgagcaggggtgagatgagt
ctggccgaggttcagtgtcaccttgacaaggagggggcttccaatctagttatcgacctc
atcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctggccattgccctt
ctggaaggaggcaacaccaccatccagcactcctttttctgtcgcttgacagaagataag
aagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcccagcaagaaatc
aaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaagacgatgaggta
gacagggatgccccatcacggaaaaaagctaaagagcccacaacacagataacagaagag
gtccgggatcagctcctggaggcctccgctgccaccaggaaagccttcaccactttcagg
agggaggccgatcctgacgaccactaccagcctggagagggcacccaggccactgccgac
aagaccaaggacgacctggagatgagcgcggtcatcaccatcatgcagcccatcctccgc
ttccttcagctcctgtgtgaaaaccacaaccgagacctgcagaacttcctccgttgccaa
aataacaagaccaactacaatctggtatgtgagaccctgcagtttctggactgtatttgt
ggaagcacaactggaggccttggtcttctgggcttgtatataaatgaaaagaacgtagcg
cttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggaccttgccatgagaac
cagaactgcatagccacccatgaatccaatggcattgacatcatcacagccctgatcctc
aatgatatcaatcctttgggaaagaagaggatggacctcgtgttagaactgaagaacaat
gcctcgaagttgctcctggccatcatggaaagcaggcacgacagtgaaaacgcagagagg
atactttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacatgcaa
ggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcgtcccccaggaac
gtggggcacaacatctacatattagcccatcagttggctcggcataacaaagaacttcag
agcatgctgaaacctggtggccaagtggacggagatgaagccctggagttttatgccaag
cacacggcgcagatagagattgtcagattagaccgaacaatggaacagatagtctttccc
gtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatttactatactaca
gagagagacgaacaaggcagcaaaatcaatgatttctttctgcggtctgaagacctcttc
aatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgc
aacatgtctttctggagcagcatttcgtttaacctggccgtcctgatgaacctgcttgtg
gcgtttttctacccgtttaagggagtccgaggagctttgccttttgaaggatttcaaaag
ggaagaggaaccctggagccccactggtcgggactcctgtggacagccatgctcatctct
ctggccatcgtcattgccctccccaagccccatggcatccgggccttaattgcctccaca
attctacgattgatattttcagtcgggttacaacccacgttgtttcttctgggcgctttc
aatgtatgcaataaaatcatctttctaatgagctttgtgggcaactgtgggacattcaca
agaggctaccgagccatggttctggatgttgagttcctctatcatttgttgtatctggtg
atctgtgccatggggctctttttccatgaattcttctacagtctgctgctttttgattta
gtgtacagagaagagactttgcttaatgtcattaaaagtgtcactcgcaatggacggtcc
atcatcctgacagcagttctggctctgatcctcgtttacctgttctcgatagtgggctac
cttttcttcaaggatgactttatcttggaagtagataggctgcccaatgaaacagctgtt
ccagaaaccggcgagagtttggcaagcgagttcctgttctccgatgtgtgtagggtggag
agtggggagaactgctcctctcctgcacccagagaagagctggtccctgcagaagagacg
gaacaggataaagagcacacatgtgagacgctgctgatgtgcattgtcactgtactgagt
cacgggctgcggagcgggggtggagtaggagatgtgctcaggaagccgtccaaagaggaa
cccctgtttgctgctagagttatttatgacctcttgttcttcttcatggttatcatcatt
gttcttaacctgatttttggggttatcattgacacttttgctgacctgaggagtgagaag
cagaagaaggaagagatcttgaagaccacgtgctttatctgtggcttggaaagagacaag
tttgacaacaagactgtcacctttgaagagcacatcaaggaagaacacaacatgtggcac
tatctgtgcttcatcgtcctggtgaaagtaaaggactccaccgaatatactgggcctgag
agttacgtggcagaaatgatcaaggaaagaaaccttgactggttccccaggatgagagcc
atgtcattggtcagcagtgattctgaaggagaacagaatgagctgagaaacctgcaggag
aagctggagtccaccatgaaacttgtcacgaacctttctggccagctgtcggaattaaag
gatcagatgacagaacaaaggaagcagaaacaaagaatcggtcttctaggacatcctcct
cacatgaatgtcaacccacaacaaccggcataa

DBGET integrated database retrieval system