KEGG   Pan paniscus (bonobo): 100981083
Entry
100981083         CDS       T02283                                 

Gene name
IGF1R
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04144  Endocytosis
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04510  Focal adhesion
pps04520  Adherens junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04730  Long-term depression
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05205  Proteoglycans in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100981083 (IGF1R)
   04014 Ras signaling pathway
    100981083 (IGF1R)
   04015 Rap1 signaling pathway
    100981083 (IGF1R)
   04066 HIF-1 signaling pathway
    100981083 (IGF1R)
   04068 FoxO signaling pathway
    100981083 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100981083 (IGF1R)
   04152 AMPK signaling pathway
    100981083 (IGF1R)
   04150 mTOR signaling pathway
    100981083 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100981083 (IGF1R)
   04140 Autophagy - animal
    100981083 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100981083 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100981083 (IGF1R)
   04520 Adherens junction
    100981083 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100981083 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100981083 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100981083 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100981083 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100981083 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100981083 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100981083 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100981083 (IGF1R)
   05205 Proteoglycans in cancer
    100981083 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100981083 (IGF1R)
   05214 Glioma
    100981083 (IGF1R)
   05218 Melanoma
    100981083 (IGF1R)
   05215 Prostate cancer
    100981083 (IGF1R)
   05224 Breast cancer
    100981083 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100981083 (IGF1R)
   01522 Endocrine resistance
    100981083 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100981083 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100981083 (IGF1R)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100981083 (IGF1R)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100981083 (IGF1R)
CD molecules [BR:pps04090]
 Proteins
  100981083 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Furin-like Recep_L_domain fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100981083
NCBI-ProteinID: XP_008968133
Position
15
AA seq 1243 aa
MTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDL
CPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSA
PDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDG
ECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLL
INIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFY
VLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRN
NGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQ
DACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEI
LYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHN
YCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESR
VDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWE
PRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNY
TARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRK
RNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVV
LWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLE
IISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASLPLPDRHSGHK
AENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggccatc
aggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatcctg
gatgcggtgtccaataactacattgtggggaataagcccccaaaggaatgtggggacctg
tgtccagggaccatggaggagaagccgatgtgtgagaagaccaccatcaacaatgagtac
aactaccgctgctggaccacaaaccgctgccagaaaatgtgcccgagcacgtgtgggaag
cgggcgtgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagcgcg
cctgacaacgacacggcctgtgtagcttgccgccactactactatgccggtgtctgtgtg
cctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgacttc
tgcgccaacatcctcagcgccgagagcagcgactccgaggggtttgtgatccacgacggc
gagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtactgc
atcccttgtgaaggtccttgcccgaaggtctgtgaggaagaaaagaaaacaaagaccatt
gattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttgctc
attaacatccgacgggggaataacattgcttcagaactggagaacttcatggggctcatc
gaggtggtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtccttc
ctaaaaaaccttcgcctcatcttaggagaggagcagctagaagggaattactccttctac
gtcctcgacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgaccatc
aaagcagggaaaatgtactttgctttcaatcccaaattatgtgtttccgaaatttaccgc
atggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccaggaac
aacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacgtcg
aagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctcatc
agcttcaccgtttactacaaggaagcaccctttaagaatgtcacggagtatgatgggcag
gacgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaaggac
gtggagcccggcatcttactacatgggctgaagccctggactcagtacgccgtttacgtc
aaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgagatc
ttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagcatcg
aactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaacctg
agttactacattgttcgctggcagcggcagcctcaggacggctacctttaccggcacaat
tactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacattgag
gaggtcacagagaaccccaagactgaggtgtgtggtggggagaaagggccttgctgcgcc
tgccccaaaactgaagccgagaagcaggccgagaaggaggaggctgaataccgcaaagtc
tttgagaatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggagagat
gtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgcagac
acctacaacatcaccgacccggaagagctggagacagagtaccctttctttgagagcaga
gtggataacaaggagagaactgtgatttctaaccttcggcctttcacattgtaccgcatc
gatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaactttgtc
tttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgggag
ccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatggattg
attctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtgtcc
agacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaactac
acagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtgttc
ttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctgccc
gtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccatagaaag
agaaataacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtacttc
agcgctgctgatgtgtacgttcccgatgagtgggaggtggctcgggagaagatcaccatg
agccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtg
gtgaaagatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagcatg
cgtgaaaggattgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcaccat
gtggtgcgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaactg
atgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaataat
ccagtcctagcacctccaagcctgagcaagatgattcagatggccggagagattgcagac
ggcatggcatacctcaacgccaataagttcgtccacagagaccttgctgcccggaattgc
atggtagccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatctat
gagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtctccc
gagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtcgtc
ctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaagtc
cttcgcttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatgctg
tttgaactgatgcgcatgtgctggcagtataaccccaagatgaggccttccttcctggag
atcatcagcagcatcaaagaggagatggagcctggcttccgggaggtctccttctactac
agcgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatggag
agcgtccccctggacccctcggcctccctgccactgcccgacagacactcaggacacaag
gccgagaacggccccggccctggggtgctggtcctccgcgccagcttcgacgagagacag
ccgtacgcacacatgaacgggggccgcaagaacgagcgggccttgccgctgccccagtct
tcgacctgctga

DBGET integrated database retrieval system