KEGG   Pan paniscus (bonobo): 100981582
Entry
100981582         CDS       T02283                                 

Gene name
PDE1A
Definition
(RefSeq) phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04740  Olfactory transduction
pps04742  Taste transduction
pps04924  Renin secretion
pps05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100981582 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100981582 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100981582 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    100981582 (PDE1A)
   04742 Taste transduction
    100981582 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100981582 (PDE1A)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100981582 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100981582
NCBI-ProteinID: XP_008975430
Position
2B
AA seq 563 aa
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQALSSDHVLHHVSSTIEQEY
AFDRVELSEEARTSSQKCEFIHQ
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggggtctagtgccacagagattgaagaattggaaaacaccacttttaagtatcttaca
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttggtgaag
cagctggaaagaggtgatgttaacgtcgtcgacttaaagaagaatattgaatatgcggca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtcccatctgaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaagaatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatcgtaacattaaaggatgttgataagtgg
tctttcgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgtttcttgccta
atcacctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgctgctgccattcatgat
tatgagcatacagggacaacgaacaactttcacattcagacaaggtcagatgttgccatt
ttgtataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaagaaatgaatatcttgataaatttatccaaagatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagcaaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaaccatgtccctg
attctccacgcagcagacatcagccacccagccaaatcctggaagctgcattatcggtgg
accatggccctaatggaggagtttttcctgcagggagataaagaagctgaattagggctt
ccattttccccactttgtgatcggaagtcaaccatggtggcccagtcacaaataggtttc
atcgatttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaacttcttcctatgtggcaagcagctca
accaccattgtggggttacacattgctgatgcactaagacgatcaaatacaaaaggctcc
atgagtgatgggtcctattccccagactactcccttgcagcagtggacctgaagagtttc
aagaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttagctgca
caagctttgtcttcagatcatgttctacatcatgttagcagtacaatagagcaggagtat
gcatttgatagagtggaactttcagaagaagcaagaaccagttcacagaagtgtgagttt
atccatcagtaa

KEGG   Pan paniscus (bonobo): 100989825
Entry
100989825         CDS       T02283                                 

Gene name
PDE1C
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04740  Olfactory transduction
pps04742  Taste transduction
pps04924  Renin secretion
pps05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100989825 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100989825 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100989825 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    100989825 (PDE1C)
   04742 Taste transduction
    100989825 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100989825 (PDE1C)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100989825 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100989825
NCBI-ProteinID: XP_003833444
UniProt: A0A2R9CEK6
Position
7
AA seq 709 aa
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKMSGETKNQVNGTQANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKCPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggagtcgccaaccaaggagattgaagaatttgagagcaactctctgaaatacctgcaa
ccggaacagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgacgagaagccccggttcaagagcatcgttcacgcagtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgacgtcttttccctcaatgaggccagt
ggggatcatgcactgaaatttattttctatgaactactcacacgctatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgatgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtataatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattttgattaac
ctctcaaaggatgactggagggagtttcgaaccttggtaattgaaatggtgatggccaca
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacagcagatattagccatcca
gcaaaagcatgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagagctggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcatcgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaatcgatgaaacctctcaaact
ggtgggacaggacagaggcgttcgagtttgaatagcatcagctcgtcagatgccaagcga
tcaggtgtcaagacctctggttcagagggaagtgccccgatcaacaattctgtcatctcc
gttgactataagagctttaaagctacttggacggaagtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgt
ctggccgcagaggagcagcaaaaggaaatggaagccaaaagccaggctgaagaaggcgca
tctggcaaagctgagaaaaagatgtctggagaaactaagaatcaagtcaatggaacacag
gcaaacaaaagtgacaaccctcgtgggaaaaattccaaagctgagaagtcatcaggagaa
cagcaacagaatggtgacttcaaagatggtaaaaataagacagacaagaaggatcactct
aacatcggaaacgattcaaagaaaacagatggcacaaaacagcgttctcacggctcacca
gccccaagcaccagctccacgtgtcgccttacgttgccagtcatcaagcctcctttgcgt
cattttaaatgccctgcttacgcatctagctcctatgcaccttcagtctcaaagaaaact
gatgagcatcctgcaaggtacaagatgctggatcagaggatcaaaatgaaaaagattcag
aacatctcacataactggaacagaaaatag

KEGG   Pan paniscus (bonobo): 100995565
Entry
100995565         CDS       T02283                                 

Gene name
PDE1B
Definition
(RefSeq) phosphodiesterase 1B
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04740  Olfactory transduction
pps04742  Taste transduction
pps04924  Renin secretion
pps05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100995565 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100995565 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100995565 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    100995565 (PDE1B)
   04742 Taste transduction
    100995565 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100995565 (PDE1B)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100995565 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 100995565
NCBI-ProteinID: XP_003807610
Position
12
AA seq 536 aa
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNRAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGIANQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccggagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcagcccccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggagaatggggagataaacattgaggagctgaagaaaaatctg
gagtacacagcttctctgctggaagccgtctacatagatgagacacggcaaatcttggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcacgctgtgcaggctgggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttactctactgcggttctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccgggcagcagatgaccatgccctg
aggaccattgtttttgagttgctgactcggcataacctcatcagccgcttcaagattccc
actgtgtttttgatgagtttcctggatgccttggagacaggctatgggaagtacaagaat
ccttaccacaaccagatccacgcagccgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgagctcctggccatcatctttgctgca
gctatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtcg
gaatgtgccatcctgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgactgatgcaggatgatgagatgaacattttcatcaacctcaccaaggatgagttt
gtagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgccatttc
cagcaagtgaagaccatgaagacagccttgcaacagctggagaggattgacaagcccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggttggtc
cacagccgttggaccaaggccctcatggaggaattcttccgtcagggtgacaaggaggca
gagttgggcctgcccttttctccactctgtgaccgcacttccactctagtggcacagtct
cagatagggttcatcgacttcattgtggagcccacattctctgtgctgactgatgtggca
gagaagagtgttcagcccctggcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgccagccctctctggatgtggaagtgggagaccccaaccctgatgtggtcagc
tttcgttccacctgggtcaagcgcattcaggagaacaagcagaaatggaaggaacgggca
gcaagcggcatcgccaaccagatgtccattgacgagctgtccccctgtgaagaagaggcc
cccccatcccctgccgaagatgaacacaaccagaatgggaatctggattag

DBGET integrated database retrieval system