KEGG   Pan paniscus (bonobo): 100982035
Entry
100982035         CDS       T02283                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04310  Wnt signaling pathway
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04670  Leukocyte transendothelial migration
pps04916  Melanogenesis
pps04919  Thyroid hormone signaling pathway
pps04934  Cushing syndrome
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05160  Hepatitis C
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100982035 (CTNNB1)
   04310 Wnt signaling pathway
    100982035 (CTNNB1)
   04390 Hippo signaling pathway
    100982035 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100982035 (CTNNB1)
   04520 Adherens junction
    100982035 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100982035 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100982035 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100982035 (CTNNB1)
   04916 Melanogenesis
    100982035 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100982035 (CTNNB1)
   05205 Proteoglycans in cancer
    100982035 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100982035 (CTNNB1)
   05225 Hepatocellular carcinoma
    100982035 (CTNNB1)
   05226 Gastric cancer
    100982035 (CTNNB1)
   05216 Thyroid cancer
    100982035 (CTNNB1)
   05217 Basal cell carcinoma
    100982035 (CTNNB1)
   05215 Prostate cancer
    100982035 (CTNNB1)
   05213 Endometrial cancer
    100982035 (CTNNB1)
   05224 Breast cancer
    100982035 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100982035 (CTNNB1)
   05163 Human cytomegalovirus infection
    100982035 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982035 (CTNNB1)
   05165 Human papillomavirus infection
    100982035 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100982035 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100982035 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100982035 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100982035 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100982035 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100982035 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100982035 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100982035
NCBI-ProteinID: XP_008949747
UniProt: A0A2R9BC13
Position
3
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttcccc
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtccgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttacataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgtgaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttacgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggcggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgtcttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system