KEGG   Pan paniscus (bonobo): 100982675
Entry
100982675         CDS       T02283                                 

Gene name
IL11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100982675 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100982675 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100982675 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100982675 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100982675 (IL11)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100982675 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 100982675
NCBI-ProteinID: XP_003807149
UniProt: A0A2R9BY61
Position
19
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggccaccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctccctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccgggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccggctggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagccacccccggacccgccggcgcccccg
ctggcgcccccctcctcagcctggggaggcatcagggccgcccacgccatcctggggggg
ctacacctgacacttgactgggccgtgaggggactgctgctgctgaagactcggctgtga

DBGET integrated database retrieval system