KEGG   Pan paniscus (bonobo): 100982764
Entry
100982764         CDS       T02283                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100982764 (GADD45B)
   04064 NF-kappa B signaling pathway
    100982764 (GADD45B)
   04068 FoxO signaling pathway
    100982764 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100982764 (GADD45B)
   04210 Apoptosis
    100982764 (GADD45B)
   04115 p53 signaling pathway
    100982764 (GADD45B)
   04218 Cellular senescence
    100982764 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100982764 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100982764 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100982764 (GADD45B)
   05212 Pancreatic cancer
    100982764 (GADD45B)
   05225 Hepatocellular carcinoma
    100982764 (GADD45B)
   05226 Gastric cancer
    100982764 (GADD45B)
   05214 Glioma
    100982764 (GADD45B)
   05216 Thyroid cancer
    100982764 (GADD45B)
   05220 Chronic myeloid leukemia
    100982764 (GADD45B)
   05217 Basal cell carcinoma
    100982764 (GADD45B)
   05218 Melanoma
    100982764 (GADD45B)
   05213 Endometrial cancer
    100982764 (GADD45B)
   05224 Breast cancer
    100982764 (GADD45B)
   05222 Small cell lung cancer
    100982764 (GADD45B)
   05223 Non-small cell lung cancer
    100982764 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100982764 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100982764 (GADD45B)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100982764 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100982764 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100982764
NCBI-ProteinID: XP_003819287
UniProt: A0A2R9CMK8
Position
19
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctcccttcaggaacgc
tga

KEGG   Pan paniscus (bonobo): 100990548
Entry
100990548         CDS       T02283                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100990548 (GADD45A)
   04064 NF-kappa B signaling pathway
    100990548 (GADD45A)
   04068 FoxO signaling pathway
    100990548 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100990548 (GADD45A)
   04210 Apoptosis
    100990548 (GADD45A)
   04115 p53 signaling pathway
    100990548 (GADD45A)
   04218 Cellular senescence
    100990548 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990548 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100990548 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100990548 (GADD45A)
   05212 Pancreatic cancer
    100990548 (GADD45A)
   05225 Hepatocellular carcinoma
    100990548 (GADD45A)
   05226 Gastric cancer
    100990548 (GADD45A)
   05214 Glioma
    100990548 (GADD45A)
   05216 Thyroid cancer
    100990548 (GADD45A)
   05220 Chronic myeloid leukemia
    100990548 (GADD45A)
   05217 Basal cell carcinoma
    100990548 (GADD45A)
   05218 Melanoma
    100990548 (GADD45A)
   05213 Endometrial cancer
    100990548 (GADD45A)
   05224 Breast cancer
    100990548 (GADD45A)
   05222 Small cell lung cancer
    100990548 (GADD45A)
   05223 Non-small cell lung cancer
    100990548 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100990548 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100990548 (GADD45A)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100990548 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100990548 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100990548
NCBI-ProteinID: XP_003807918
UniProt: A0A2R9CAI8
Position
1
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaagctgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcaatgggttccagtgatt
aatctccctgaacggtga

KEGG   Pan paniscus (bonobo): 100992917
Entry
100992917         CDS       T02283                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05216  Thyroid cancer
pps05217  Basal cell carcinoma
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100992917 (GADD45G)
   04064 NF-kappa B signaling pathway
    100992917 (GADD45G)
   04068 FoxO signaling pathway
    100992917 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100992917 (GADD45G)
   04210 Apoptosis
    100992917 (GADD45G)
   04115 p53 signaling pathway
    100992917 (GADD45G)
   04218 Cellular senescence
    100992917 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100992917 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100992917 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100992917 (GADD45G)
   05212 Pancreatic cancer
    100992917 (GADD45G)
   05225 Hepatocellular carcinoma
    100992917 (GADD45G)
   05226 Gastric cancer
    100992917 (GADD45G)
   05214 Glioma
    100992917 (GADD45G)
   05216 Thyroid cancer
    100992917 (GADD45G)
   05220 Chronic myeloid leukemia
    100992917 (GADD45G)
   05217 Basal cell carcinoma
    100992917 (GADD45G)
   05218 Melanoma
    100992917 (GADD45G)
   05213 Endometrial cancer
    100992917 (GADD45G)
   05224 Breast cancer
    100992917 (GADD45G)
   05222 Small cell lung cancer
    100992917 (GADD45G)
   05223 Non-small cell lung cancer
    100992917 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100992917 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100992917 (GADD45G)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100992917 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100992917 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100992917
NCBI-ProteinID: XP_003806360
UniProt: A0A2R9A4M5
Position
9
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcggatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

DBGET integrated database retrieval system