KEGG   Pan paniscus (bonobo): 100982795
Entry
100982795         CDS       T02283                                 

Definition
(RefSeq) complement receptor type 1
  KO
K04011  complement component (3b/4b) receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04610  Complement and coagulation cascades
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05144  Malaria
pps05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100982795
   04610 Complement and coagulation cascades
    100982795
   04613 Neutrophil extracellular trap formation
    100982795
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100982795
   05152 Tuberculosis
    100982795
  09174 Infectious disease: parasitic
   05144 Malaria
    100982795
   05140 Leishmaniasis
    100982795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100982795
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100982795
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100982795
CD molecules [BR:pps04090]
 Proteins
  100982795
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100982795
NCBI-ProteinID: XP_003822941
Position
1
AA seq 584 aa
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDE
SEFPIGTYLNYECRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKD
IQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTIANGDFIST
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCMP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPPLVKCQALNKWEPELPSCSRVCQPP
PDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASLRCTPQGDWSPATPTCEVKSCDG
FMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKAVNYTCDPHPDRGMTFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYKCRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTG
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgggggcctcttctccaagaagcccggagcctgtcgggccgccggcgcccggtctcccc
ttctgctgcggaggatccctgctggcggttgtggtgctgcttgcgctgccggtggcctgg
ggtcaatgcaatgccccagaatggcttccatttgccaggcctaccaacctaactgatgag
tctgagtttcccattgggacatatctgaactatgaatgccgccctggttattatggaaga
ccgttttctatcatctgcctaaaaaactcagtctggactggtgctaaggacaggtgcaga
cgtaaatcatgtcgtaatcctccagatcctgtgaatggcatggtgcatgtgatcaaagac
atccaattcggatcccaaattaaatattcttgtactaaaggataccgactcattggttcc
tcgtctgccacatgcatcatctcaggtgatactgtcatttgggataatgaaacacctatt
tgtgacagaattccttgtgggctaccccccaccatcgccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcctggaagcgga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggcccggcccctcagtgcattatacctaacaaatgcatgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggaatttaggtgtcagcctggctttgtcatgaaaggacccccccttgtgaagtgc
caggccctgaacaaatgggagcccgagctaccaagctgctccagggtatgtcagccacct
ccagatgtcctgcatgctgagcgtacccaaagggacaaggacaacttttcacccgggcag
gaagtgttctacagctgtgagcccggctacgacctcagaggggctgcatctctgcgctgc
acaccccagggagactggagccctgcaacccccacatgtgaagtgaaatcctgtgatggc
ttcatgggccaacttcttaatggccgtgtgctatttccagtaaatctccagcttggagca
aaagtggattttgtttgtgatgaaggatttcaattaaaaggcagctctgctagttactgt
gtcttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaaatcttt
tgtccaagtcctccagttattcctaacgggagacacacaggaaaacctctggaagtcttt
ccctttggaaaagcagtaaattacacatgcgacccccacccagacagagggatgaccttc
gacctcattggagagagcaccatccgctgcacaagtgaccctcaagggaatggggtttgg
agcagccctgcccctcgctgtggaattctgggtcactgtcaagccccagatcattttctg
tttgccaagttgaaaacacaaaccaatgcatctgactttcccattgggacatctttaaag
tacaaatgccgtcctgagtactacgggaggccattttctatcacatgtctagataacctg
gtctggtcaagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctccagatcca
gtgaatggcatggtgcatgtgatcacagacatccaggttggatccagaatcaactattct
tgtactacagggtga

KEGG   Pan paniscus (bonobo): 100992972
Entry
100992972         CDS       T02283                                 

Gene name
CR1
Definition
(RefSeq) complement C3b/C4b receptor 1 (Knops blood group)
  KO
K04011  complement component (3b/4b) receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04610  Complement and coagulation cascades
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05144  Malaria
pps05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100992972 (CR1)
   04610 Complement and coagulation cascades
    100992972 (CR1)
   04613 Neutrophil extracellular trap formation
    100992972 (CR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100992972 (CR1)
   05152 Tuberculosis
    100992972 (CR1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100992972 (CR1)
   05140 Leishmaniasis
    100992972 (CR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100992972 (CR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100992972 (CR1)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100992972 (CR1)
CD molecules [BR:pps04090]
 Proteins
  100992972 (CR1)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100992972
NCBI-ProteinID: XP_008954885
Position
1
AA seq 1355 aa
CQPPPDVLHAERTQRXKDNFSPGQEVFYSCEPGYDHRGAASLRCTPQGDWSPAAPTCEVK
SCDGFMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVC
EQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTCDPHPDRGTTFDLIGESTIHCTSDPQG
NGVWSSPAPRCGILGIRCSQHTVQLLVLTLAQHTVEALPQSHSSWEQLSQVANTGYVRVT
TTDTERKHRLIGHSSAECILSGNAAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHY
GSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGI
LVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPPPEILHGE
HTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDDFLGQLPH
GRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEQIFCPNPPAI
LNGRHTGTPFGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSSAPRC
GSLGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKD
VCRRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGAAIKKYRSSSFYCHCKTPEQFPF
ASPTIPINDFEFPVGTSLNYECHPGYFGKMFSISCLENLVWSSVEDNCRRKSCGPPPEPF
NGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPT
ISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQLFELVGERSIYCTSKDDQVGVWSSPPPR
CISTNKCTAPEVENAIRVPGNRSFFSLTEIVRFRCQPGFVMVGSHTVQCQTNGRWGPKLP
HCSRVCQPPPEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAP
RCTVKSCDDFLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGRSASHCVLAGMKALWNS
SVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCT
SDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHDIGGHVSLYLPGMTISYICDPGYLLV
GKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTL
EGSPWSQCQADDRWDPPLAKCTSRAHDALIVGTSSGTIFFILLIIFLSWIILKHRKGNNA
HEKPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
NT seq 4070 nt   +upstreamnt  +downstreamnt
tatgtcaaccacctccagatgtcctgcatgctgagcgtacccaaaggngcaaggacaact
tttcacccgggcaggaggtgttctacagctgtgagcccggctacgaccacagaggggctg
cgtctctgcgctgcacaccccagggagactggagccctgcagcccccacatgtgaagtga
aatcctgtgatggcttcatgggccaacttcttaatggccgtgtgctatttccagtaaatc
tccagcttggagcaaaagtggattttgtttgtgatgaaggatttcaactaaaaggcagct
ctgctagttactgtgtcttggctggaatggaaagcctttggaatagcagtgttccagtgt
gtgaacaaatcttttgtccaagtcctccagttattcctaacgggagacacacaggaaaac
ctctggaagtctttccctttggaaaagcagtaaattacacatgcgacccccacccagaca
gagggacgaccttcgacctcattggagagagcaccatccactgcacaagtgaccctcaag
ggaatggggtttggagcagccctgcccctcgctgtggaattctgggcatcaggtgctcac
agcacacggtccagctgttggtgctcacccttgctcagcacacagtggaggctctgcctc
aatctcattcttcatgggaacagctaagccaggtagcgaatacgggttacgttcgtgtca
ccacaacagacactgaaaggaagcaccgactcattggtcactcatctgctgaatgtatcc
tctcgggcaatgctgcccattggagcacgaagccgccaatttgtcaacgaattccttgtg
ggctacccccaaccattgccaatggagatttcattagcaccaacagagagaattttcact
atggatcagtggtgacctaccgctgcaatcttggaagcagagggagaaaggtgtttgagc
ttgtgggtgagccctccatatactgcaccagcaatgacgatcaagtgggcatctggagcg
gccccgcccctcagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaa
tattggtatctgacaacagaagcttattttccttaaatgaagttgtggagtttaggtgtc
agcctggctttgtcatgaaaggaccccgccgtgtgaagtgccaggccctgaacaaatggg
agccagagttaccaagctgctccagggtgtgtcagccgcctccagaaatcctgcatggtg
agcataccccaagccatcaggacaacttttcacctgggcaggaagtgttctacagctgtg
agcctggctatgacctcagaggggctgcgtctctgcactgcacaccccagggagactgga
gccctgaagccccgagatgtgcagtgaaatcctgtgatgacttcttgggtcaactccctc
atggccgtgtgctatttccacttaatctccagcttggggcaaaggtgtcctttgtctgtg
atgaagggtttcgcttaaagggcagttccgttagtcattgtgtcttggttggaatgagaa
gcctttggaataacagtgttcctgtgtgtgaacaaatcttttgtccaaatcctccagcta
tccttaatgggagacacacaggaactccctttggagatattccctatggaaaagaaatat
cttacacatgtgacccccacccagacagagggatgaccttcaacctcattggggagagca
ccatccgctgcacaagtgaccctcatgggaatggggtttggagcagctctgcccctcgct
gtgggtctctaggtcactgtcaagccccggatcattttctgtttgctaagctcaaaacac
aaaccaatgcatctgactttcccattgggacatctttaaagtatgaatgccgtcctgagt
actacgggaggccattctctatcacatgtctagataacctggtctggtccagtcccaaag
atgtctgtagacgtaaatcatgtaaaactcctccagatccagtgaatggcatggtgcatg
tgatcacagacatccaggttggatccagaatcaactattcttgtactacaggtgctgcca
tcaaaaagtacaggtcttcctcgttttattgtcactgtaaaaccccagagcagtttccat
ttgccagtcctacgatcccaattaatgactttgagtttccagtcgggacatctttgaatt
atgaatgccatcctgggtattttgggaaaatgttctctatctcctgcctagaaaacttgg
tctggtcaagtgttgaagacaactgtagacgaaaatcatgtggacctccaccagaaccct
tcaatggaatggtgcatataaacacagatacacagtttggatcaacagttaattattctt
gtaatgaaggctttcgactcattggttccccatctaccacttgtctcgtctcaggcaata
atgtcacatgggataagaaggcacctatttgtgagatcatatcttgtgagccacctccaa
ccatatccaatggagacttctacagcaacaatagaacatcttttcacaatggaacagtgg
taacttaccagtgccacactggaccagatggagaacagctgtttgagctcgtgggagaac
ggtcaatatattgcaccagcaaagatgatcaagttggtgtttggagcagccctccccctc
ggtgtatttctactaataaatgcacagctccagaagttgaaaatgcaattcgagtaccag
gaaataggagtttcttttccctcactgagatcgtcagatttagatgtcagcccgggtttg
tcatggtagggtcccacactgtgcagtgccagaccaacggcagatgggggcccaagctgc
cacactgctccagggtgtgtcagccgcctccagaaatcctgcatggtgagcataccccaa
gccatcaggacaacttttcacctgggcaggaagtgttctacagctgtgagcccggctatg
acctcagaggggctgcgtctctgcactgcacgccccagggagactggagccctgaagccc
ctagatgcacagtgaaatcctgtgatgacttcctgggccaactccctcatggccgtgtgc
tgtttccacttaatctccagcttggggcaaaggtgtcctttgtttgcgatgaagggttcc
gattaaaaggcaggtctgctagtcattgtgtcttggctggaatgaaagccctttggaata
gcagtgttccagtgtgtgaacaaatcttttgtccaaatcctccagctatccttaatggga
gacacacaggaactccctttggagatattccctatggaaaagaaatatcttacgcatgcg
acacccacccagacagagggatgaccttcaacctcattggggagagctccatccgctgca
caagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgtgaactttctg
ttcctgctgcctgcccacatccacccaagatccaaaatgggcatgacattggaggacatg
tatctctatatcttcctgggatgacaatcagctacatttgtgaccccggctacctgttag
tgggaaagggcttcattttctgtacagaccagggaatctggagccaattggatcattatt
gcaaagaagtaaattgtagcttcccactgtttatgaatggaatctcgaaggagttagaaa
tgaaaaaagtatatcactatggagattatgtgactttgaagtgtgaagatgggtatactc
tggaaggcagtccctggagccagtgccaggcggatgacagatgggaccctcctctggcca
aatgtacctctcgtgcacatgatgctctcatagttggcacttcatctggtacgatcttct
ttattttactcatcattttcctctcttggataattctaaagcacagaaaaggcaataatg
cacatgaaaaacctaaagaagtggctatccatttacattctcaaggaggcagcagcgttc
atccccgaactctgcaaacaaatgaagaaaatagcagggtccttccttga

KEGG   Pan paniscus (bonobo): 103783766
Entry
103783766         CDS       T02283                                 

Definition
(RefSeq) complement component receptor 1-like protein
  KO
K04011  complement component (3b/4b) receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04610  Complement and coagulation cascades
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05144  Malaria
pps05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103783766
   04610 Complement and coagulation cascades
    103783766
   04613 Neutrophil extracellular trap formation
    103783766
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103783766
   05152 Tuberculosis
    103783766
  09174 Infectious disease: parasitic
   05144 Malaria
    103783766
   05140 Leishmaniasis
    103783766
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    103783766
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    103783766
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    103783766
CD molecules [BR:pps04090]
 Proteins
  103783766
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 103783766
NCBI-ProteinID: XP_008954842
UniProt: A0A2R8Z9Z5
Position
1
AA seq 569 aa
MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDEFEFPIGTY
LNYECRPGYYGRPFSIICLKNSVWTSAEDKCKRKSCRNPPDPVNGMVHVIKDIQFGSQIK
YSCIKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYA
SVVTYHCNLGSGGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGIL
VSDNRSLFSLNEVVEFRCQPGFVMKGPRHVHCQALNKWEPELPSCSRVCQPPPDVLHGER
TQRDKDNFSPGEEVYYSCEPGYDLRGSTYLHCTPQGDWSPEAPRCEVKSCDDFLGQLPNG
RVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPV
NGMVHVITDIHVGSRINYSCITGHRLIGHSSAECILSGNTAHWSMKPPICQQIFCPNPPA
ILNGRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPR
CELPVGAGSHDALIVGKFYEVFAEEFWHL
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcgcctcccgtccgtctcgagcgtccctttccttcccggcgctttcctgggttgctt
ctggcggcgctggtgttgctgctgtcctccttctccgatcaatgcaatgtcccggaatgg
cttccatttgccaggcctaccaacctaactgatgagtttgagtttcccattgggacatat
ctgaactatgaatgccgccctggttattatggaagaccattttctatcatctgcctaaaa
aactcagtctggaccagtgctgaggacaagtgcaaacgtaaatcatgtcgtaatcctcca
gatcctgtgaatggcatggtgcatgtgatcaaagacatccagttcggatcccaaattaaa
tattcttgtattaaaggataccgactcattggttcctcgtctgccacatgcatcatctca
ggcaacactgtcatttgggataataaaacacctgtttgtgacagaattatttgtgggcta
ccccccaccatcgccaatggagatttcactagcatcagcagagagtattttcactatgca
tcagtggtgacctaccactgcaatcttggaagcggagggaaaaaggtgtttgagcttgtg
ggtgagccctccatatactgcaccagcaaagatgatcaagtgggcatctggagtggcccg
gcccctcagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattg
gtatctgacaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcct
ggctttgtcatgaaaggaccccgccatgtgcactgccaggccctgaacaaatgggagccg
gagctaccaagctgctccagggtatgtcaaccgcctccagatgtcctgcatggtgagcgt
acccaaagggacaaggacaacttttcacccggggaggaagtgtactacagctgtgagccc
ggctatgacctcagaggatctacgtatttgcactgcacaccccagggagactggagccct
gaagcccccagatgtgaagtgaaatcctgtgatgacttcctgggccaacttcctaatggc
cgtgtgctatttccacttaatctccagcttggagcaaaagtggattttgtttgtgatgaa
ggatttcaattaaaaggcagctctgctagttactgtgttttggctggaatggaaagcctt
tggaatagcagtgttccagtgtgtgaacgtaaatcatgtgaaactcctccagttccagtg
aatggcatggtgcatgtgatcacagacatccatgttggatccagaatcaactattcttgt
attacagggcaccgactcattggtcactcatctgctgaatgtatcctctcgggcaatact
gcccattggagcatgaagccaccaatttgtcaacaaatcttttgtccaaatcctccagct
atccttaatgggagacacacaggaactccccttggagatattccctatggaaaagaagta
tcttacacatgtgacccccacccagacagagggatgaccttcaacctcattggggagagc
accatccgctgcacaagtgaccctcatgggaatggggtttggagcagccctgcccctcgc
tgtgaacttcctgttggtgctggttcacatgatgctcttatagttggtaagttttatgaa
gtgtttgctgaggaattctggcatctttaa

DBGET integrated database retrieval system