KEGG   Pan paniscus (bonobo): 100982978
Entry
100982978         CDS       T02283                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04114  Oocyte meiosis
pps04115  p53 signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04510  Focal adhesion
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05205  Proteoglycans in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05224  Breast cancer
pps05410  Hypertrophic cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100982978 (IGF1)
   04014 Ras signaling pathway
    100982978 (IGF1)
   04015 Rap1 signaling pathway
    100982978 (IGF1)
   04066 HIF-1 signaling pathway
    100982978 (IGF1)
   04068 FoxO signaling pathway
    100982978 (IGF1)
   04151 PI3K-Akt signaling pathway
    100982978 (IGF1)
   04152 AMPK signaling pathway
    100982978 (IGF1)
   04150 mTOR signaling pathway
    100982978 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100982978 (IGF1)
   04115 p53 signaling pathway
    100982978 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100982978 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100982978 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100982978 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100982978 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100982978 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100982978 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100982978 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100982978 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100982978 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100982978 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100982978 (IGF1)
   05202 Transcriptional misregulation in cancer
    100982978 (IGF1)
   05205 Proteoglycans in cancer
    100982978 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100982978 (IGF1)
   05218 Melanoma
    100982978 (IGF1)
   05215 Prostate cancer
    100982978 (IGF1)
   05224 Breast cancer
    100982978 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100982978 (IGF1)
   05414 Dilated cardiomyopathy
    100982978 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100982978 (IGF1)
   01522 Endocrine resistance
    100982978 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100982978 (IGF1)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100982978 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 100982978
NCBI-ProteinID: XP_003832621
UniProt: A0A2R8ZF45
Position
12
AA seq 196 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRRKGGPKTHPGGEQKEGTEASLQIRGKKKEQR
REIGSRNAECRGKKGK
NT seq 591 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagaggagaaggaaaggtgggccaaagacacatccaggaggg
gaacagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagagg
agggagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatga

DBGET integrated database retrieval system