KEGG   Pan paniscus (bonobo): 100983073
Entry
100983073         CDS       T02283                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04110  Cell cycle
pps04137  Mitophagy - animal
pps04218  Cellular senescence
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100983073 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100983073 (E2F1)
   04218 Cellular senescence
    100983073 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100983073 (E2F1)
   05206 MicroRNAs in cancer
    100983073 (E2F1)
   05207 Chemical carcinogenesis - receptor activation
    100983073 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100983073 (E2F1)
   05225 Hepatocellular carcinoma
    100983073 (E2F1)
   05226 Gastric cancer
    100983073 (E2F1)
   05214 Glioma
    100983073 (E2F1)
   05220 Chronic myeloid leukemia
    100983073 (E2F1)
   05218 Melanoma
    100983073 (E2F1)
   05219 Bladder cancer
    100983073 (E2F1)
   05215 Prostate cancer
    100983073 (E2F1)
   05224 Breast cancer
    100983073 (E2F1)
   05222 Small cell lung cancer
    100983073 (E2F1)
   05223 Non-small cell lung cancer
    100983073 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100983073 (E2F1)
   05161 Hepatitis B
    100983073 (E2F1)
   05160 Hepatitis C
    100983073 (E2F1)
   05163 Human cytomegalovirus infection
    100983073 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100983073 (E2F1)
   05169 Epstein-Barr virus infection
    100983073 (E2F1)
   05165 Human papillomavirus infection
    100983073 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100983073 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100983073 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100983073 (E2F1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100983073 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100983073
NCBI-ProteinID: XP_014198496
UniProt: A0A2R8ZVH7
Position
20
AA seq 397 aa
MEGDTFWLGSGEVGHVAGEGSPEAPSLKPGLFWPHSWLLGILPFSPQVKRRLDLETDHQY
LAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVL
KVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQL
DHLMNICTAQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE
TFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSLPS
SLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFI
SLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggagggggatacattctggctgggttctggggaggtggggcacgtggcgggcgagggt
agcccagaggcacccagccttaagccaggtctcttctggcctcactcctggttactgggc
atcctcccgttttcgccacaggtgaagcggaggctggacctggaaactgaccatcagtac
ctggccgagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccactcggctgacggtgtcgtcgacctgaactgggctgccgaggtgctg
aaggtgcagaagcggcgcatctatgacatcaccaacgtccttgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggcagccacaccacagtgggcgtcggc
ggacggcttgaggggttgacccaggacctccgacagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactgcgcagctgcgcctgctctccgaggacactgacagc
cagcgcctggcctacgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcctgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggcccgatcgatgttttcctgtgccctgag
gagaccgtaggtgggatcagccctgggaagaccccatcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctctcccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

KEGG   Pan paniscus (bonobo): 100984393
Entry
100984393         CDS       T02283                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04110  Cell cycle
pps04218  Cellular senescence
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100984393 (E2F2)
   04218 Cellular senescence
    100984393 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984393 (E2F2)
   05206 MicroRNAs in cancer
    100984393 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100984393 (E2F2)
   05225 Hepatocellular carcinoma
    100984393 (E2F2)
   05226 Gastric cancer
    100984393 (E2F2)
   05214 Glioma
    100984393 (E2F2)
   05220 Chronic myeloid leukemia
    100984393 (E2F2)
   05218 Melanoma
    100984393 (E2F2)
   05219 Bladder cancer
    100984393 (E2F2)
   05215 Prostate cancer
    100984393 (E2F2)
   05224 Breast cancer
    100984393 (E2F2)
   05222 Small cell lung cancer
    100984393 (E2F2)
   05223 Non-small cell lung cancer
    100984393 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984393 (E2F2)
   05161 Hepatitis B
    100984393 (E2F2)
   05160 Hepatitis C
    100984393 (E2F2)
   05163 Human cytomegalovirus infection
    100984393 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984393 (E2F2)
   05169 Epstein-Barr virus infection
    100984393 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100984393 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100984393 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100984393 (E2F2)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100984393 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100984393
NCBI-ProteinID: XP_003810802
UniProt: A0A2R9C653
Position
1
AA seq 437 aa
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPAPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNMEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgcctcgacgccactccccacggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgtcgtccct
gagttcccagcccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacttcgctagggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccaccagacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatg
gagcaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgttggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcctctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcaccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccatccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgattcctacgaccttggggacctgttgattaattga

KEGG   Pan paniscus (bonobo): 100986032
Entry
100986032         CDS       T02283                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04110  Cell cycle
pps04218  Cellular senescence
pps04934  Cushing syndrome
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100986032 (E2F3)
   04218 Cellular senescence
    100986032 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100986032 (E2F3)
   05206 MicroRNAs in cancer
    100986032 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100986032 (E2F3)
   05225 Hepatocellular carcinoma
    100986032 (E2F3)
   05226 Gastric cancer
    100986032 (E2F3)
   05214 Glioma
    100986032 (E2F3)
   05220 Chronic myeloid leukemia
    100986032 (E2F3)
   05218 Melanoma
    100986032 (E2F3)
   05219 Bladder cancer
    100986032 (E2F3)
   05215 Prostate cancer
    100986032 (E2F3)
   05224 Breast cancer
    100986032 (E2F3)
   05222 Small cell lung cancer
    100986032 (E2F3)
   05223 Non-small cell lung cancer
    100986032 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100986032 (E2F3)
   05161 Hepatitis B
    100986032 (E2F3)
   05160 Hepatitis C
    100986032 (E2F3)
   05163 Human cytomegalovirus infection
    100986032 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100986032 (E2F3)
   05169 Epstein-Barr virus infection
    100986032 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100986032 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100986032 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100986032 (E2F3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100986032 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100986032
NCBI-ProteinID: XP_008975036
Position
6
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPASKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactacgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacgcggtatgatacgtctcttggtctg
ctcaccaagaagttcattcagctcctgagccagtcacccgatggggtattggatttgaac
aaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgatatcaccaacgttctg
gaaggcatccacctcattaagaagaagtctaaaaacaacgtccaatggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgactcaatagagagcctacaaatacatttggcaagtacccaagggccc
attgaggtttacttatgtccagaagagactgaaacacacagtccaatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccgcttccaaagacttggcttcaaccaactca
ggacatagcgattgctcaatttctatgggaaacctttctcctctggcctccccagccaac
ctcttacagcagactgaggaccaaattccttccaacctagaaggaccctttgtgaactta
ctgcctcccctgctgcaagaggactatctcctgagcctcggggaggaggaaggcatcagc
gatctcttcgatgcttacgatttggaaaagctcccactggtggaagacttcatgtgtagt
tga

DBGET integrated database retrieval system