KEGG   Pan paniscus (bonobo): 100983168
Entry
100983168         CDS       T02283                                 

Gene name
VDAC1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04979  Cholesterol metabolism
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100983168 (VDAC1)
   04022 cGMP-PKG signaling pathway
    100983168 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100983168 (VDAC1)
   04218 Cellular senescence
    100983168 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100983168 (VDAC1)
   04621 NOD-like receptor signaling pathway
    100983168 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    100983168 (VDAC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100983168 (VDAC1)
   05164 Influenza A
    100983168 (VDAC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100983168 (VDAC1)
   05012 Parkinson disease
    100983168 (VDAC1)
   05014 Amyotrophic lateral sclerosis
    100983168 (VDAC1)
   05016 Huntington disease
    100983168 (VDAC1)
   05017 Spinocerebellar ataxia
    100983168 (VDAC1)
   05020 Prion disease
    100983168 (VDAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100983168 (VDAC1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100983168 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100983168 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100983168 (VDAC1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    100983168 (VDAC1)
Ion channels [BR:pps04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   100983168 (VDAC1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 100983168
NCBI-ProteinID: XP_003829331
UniProt: A0A2R9BFY0
Position
5
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKIAKIKTGYKR
EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggctgtgccacccacgtatgccgatcttggcaaatctgccagggatgtcttcaccaag
ggctatggatttggcttaataaagcttgatttgaaaacaaaatctgagaatggattggaa
tttacaagctcaggctcagccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacagatggactgagtacggcctgacgtttacagagaaatggaataccgacaataca
ctaggcaccgagattactgtggaagatcagcttgcacgtggactgaagctgaccttcgat
tcatccttctcacctaacactgggaaaaaaattgctaaaatcaagacagggtacaagcgg
gagcacattaacctgggctgcgacatggatttcgacattgctgggccttccatccggggt
gctctggtgctaggttacgagggctggctggccggctaccagatgaattttgagactgca
aaatcccgagtgacccagagcaactttgcagttggctacaagactgatgaattccagctt
cacactaatgtgaatgacgggacagagtttggcggctccatttaccagaaagtgaacaag
aagttggagaccgctgtcaatcttgcctggacagcaggaaacagtaacacgcgcttcgga
atagcagccaagtatcagattgaccctgacgcctgcttctcggctaaagtgaacaactcc
agcctgataggtttaggatacactcagactctaaagccaggtattaaactgacactgtca
gctcttctggatggcaagaacgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaagcataa

KEGG   Pan paniscus (bonobo): 100987711
Entry
100987711         CDS       T02283                                 

Gene name
VDAC3
Definition
(RefSeq) voltage dependent anion channel 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04216  Ferroptosis
pps04217  Necroptosis
pps04218  Cellular senescence
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04979  Cholesterol metabolism
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05203  Viral carcinogenesis
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100987711 (VDAC3)
   04022 cGMP-PKG signaling pathway
    100987711 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100987711 (VDAC3)
   04217 Necroptosis
    100987711 (VDAC3)
   04218 Cellular senescence
    100987711 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100987711 (VDAC3)
   04621 NOD-like receptor signaling pathway
    100987711 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    100987711 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100987711 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100987711 (VDAC3)
   05161 Hepatitis B
    100987711 (VDAC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100987711 (VDAC3)
   05012 Parkinson disease
    100987711 (VDAC3)
   05016 Huntington disease
    100987711 (VDAC3)
   05017 Spinocerebellar ataxia
    100987711 (VDAC3)
   05020 Prion disease
    100987711 (VDAC3)
   05022 Pathways of neurodegeneration - multiple diseases
    100987711 (VDAC3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100987711 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100987711 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100987711 (VDAC3)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    100987711 (VDAC3)
Ion channels [BR:pps04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   100987711 (VDAC3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 100987711
NCBI-ProteinID: XP_003823328
UniProt: A0A2R9B3E1
Position
8
AA seq 283 aa
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKR
DCFSVGSNVDIDFSGPTINGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtaacacaccaacatactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaaacc
aaatataaggtctgtaactatggacttaccttcacccagaaatggaacacagacaatact
ctagggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaacga
gattgttttagtgttggcagtaatgttgatatagatttttctggaccaaccatcaatggc
tgggctgtgttggccttcgaagggtggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtcacagaataatttcgccctgggttacaaggctgcggacttccagctg
cacacacatgtgaacgatggcactgaatttggaggttctatctaccagaaggtgaatgag
aagattgaaacatccataaaccttgcttggacagctgggagtaacaacacccgttttggc
attgctgctaagtacatgctggattgtagaacttctctctctgctaaagtaaataatgcc
agcctgattggactgggttatactcagacccttcgaccaggagtcaaattgactttatca
gctttaatcgatgggaagaacttcagtgcaggaggtcacaaggttggcttgggatttgaa
ctggaagcttaa

DBGET integrated database retrieval system