KEGG   Pan paniscus (bonobo): 100984258
Entry
100984258         CDS       T02283                                 

Gene name
TLR3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04620  Toll-like receptor signaling pathway
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100984258 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100984258 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100984258 (TLR3)
   05160 Hepatitis C
    100984258 (TLR3)
   05171 Coronavirus disease - COVID-19
    100984258 (TLR3)
   05164 Influenza A
    100984258 (TLR3)
   05168 Herpes simplex virus 1 infection
    100984258 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984258 (TLR3)
   05165 Human papillomavirus infection
    100984258 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100984258 (TLR3)
   04090 CD molecules [BR:pps04090]
    100984258 (TLR3)
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100984258 (TLR3)
CD molecules [BR:pps04090]
 Proteins
  100984258 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_9 TIR_2 LRRNT LRRCT
Other DBs
NCBI-GeneID: 100984258
NCBI-ProteinID: NP_001266163
UniProt: B3Y621
Position
4
AA seq 904 aa
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPASNFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA
FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPHL
EYFFLDYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHL
NMEDNDIPGIKSNMFTGLINLKYLSLSNSFSSLRTLTNETFVSLAHSPLHILNLTKNKIS
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN
NLARLWKHANPGGPVYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNW
INETHTNIPELSSRYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV
LLIHFQGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE
DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPVCKRFKVHHAVQQAI
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgagacagactttgccttgtatctacttttgggggggccttttgccctttgggatgctg
tgtgcatcctccaccaccaagtgcactgttagccatgaagttgctgactgcagccacctg
aagttgactcaggtacccgatgatctacccacaaacataacagtgttgaaccttacccat
aatcaactcagaagattaccagcctccaactttacaaggtatagccagctaactagcttg
gatgtaggatttaacaccatctcaaaactggagccagaattgtgccagaaacttcccatg
ttaaaagttttgaacctccagcacaatgagctatctcaactttctgataaaacctttgcc
ttctgcacgaatttgactgaactccatctcatgtccaactcaatccagaaaattaaaaat
aatccctttgtcaagcagaagaatttaatcacattagatctgtctcataatggcttgtca
tctacaaaattaggaactcaggttcagctggaaaatctccaagagcttctattatcaaac
aataaaattcaagcgctaaaaagtgaagaactggatatctttgccaattcatctttaaaa
aaattagagttgtcatcgaatcaaattaaagagttttctccagggtgttttcacgcaatt
ggaagattatttggcctctttctgaacaatgtccagctgggtcccagcctcacagagaag
ctatgtttggaattagcaaacacaagcattcggaatctgtctctgagtaacagccagctg
tccaccaccagcaatacaactttcttgggactaaagtggacaaatctcactatgctcgat
ctttcctacaacaacttaaatgtggttggtaacgattcctttgcttggcttccacatcta
gaatatttcttcctggattataataatatacagcatttgttttctcactctttgcacggg
cttttcaatgtgaggtacctgaatttgaaacggtcttttactaaacaaagtatttccctt
gcttcactccccaagattgatgatttttcttttcagtggctaaaatgtttggagcacctt
aacatggaagataatgatattccaggcataaaaagcaatatgttcacaggattgataaac
ctgaaatacttaagtctatccaactccttttcaagtttgcgaactttgacaaatgaaaca
tttgtatcacttgctcattctcccttacacatactcaacctaaccaagaataaaatctca
aaaatagagagtgatgctttctcttggttgggccacctagaagtacttgacctgggcctt
aatgaaattgggcaagaactcacaggccaggaatggagaggtctagaaaatattttcgaa
atctatctttcctacaacaagtacctgcagctgactaggaactcctttgccttggtccca
agccttcaacgactgatgctccgaagggtggcccttaaaaatgtggatagctctccttca
ccattccagcctcttcgtaacttgaccattctggatctgagcaacaacaacatagccaac
ataaatgatgacatgttggagggtcttgagaaactagaaattctcgatttgcagcataac
aacttagcacggctctggaaacacgcgaaccctggtggtcccgtttatttcctaaagggt
ctgtctcacctccacatccttaacttggagtccaacggcttcgacgagatcccagttgag
gtcttcaaggatttatttgaactaaagatcatcgatttaggattgaataatttaaacaca
cttccagcatctgtctttaataatcaggtgtctctaaagtcattgaaccttcagaagaat
ctcataacatccgttgagaagaaggttttcgggccagctttcaggaacctgactgagtta
gatatgcgctttaatccctttgattgcacgtgtgaaagtattgcctggtttgttaattgg
attaacgagacccataccaacatccctgagctgtcaagccgctacctttgcaacactcca
cctcactatcatgggttcccagtgagactttttgatacatcgtcttgcaaagacagcgcc
ccctttgaactctttttcatgatcaataccagtatcctgttgatttttatctttattgta
cttctcatccactttcagggctggaggatatctttttattggaatgtttcagtacatcga
gttcttggtttcaaagaaatagacagacagacagaacagtttgaatatgcagcatatata
attcatgcctataaagataaggattgggtctgggaacatttctcttcaatggaaaaggaa
gaccaatctctcaaattttgtctggaagaaagggactttgaggcgggtgtttttgaacta
gaagcaattgttaacagcatcaaaagaagcagaaaaattatttttgttataacacaccat
ctattaaaagacccagtatgcaaaagattcaaggtacatcatgcagttcaacaagctatt
gaacaaaatctggattccattatattggttttccttgaggagattccagattataaactg
aaccatgcactctgtttgcgaagaggaatgtttaaatctcactgcatcttgaactggcca
gttcagaaagaacggataggtgcctttcgtcataaattgcaagtagcacttggatccaaa
aactctgtacattaa

DBGET integrated database retrieval system