KEGG   Pan paniscus (bonobo): 100986279
Entry
100986279         CDS       T02283                                 

Gene name
AXIN1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04310  Wnt signaling pathway
pps04390  Hippo signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04934  Cushing syndrome
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05213  Endometrial cancer
pps05217  Basal cell carcinoma
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100986279 (AXIN1)
   04390 Hippo signaling pathway
    100986279 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100986279 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100986279 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100986279 (AXIN1)
   05225 Hepatocellular carcinoma
    100986279 (AXIN1)
   05226 Gastric cancer
    100986279 (AXIN1)
   05217 Basal cell carcinoma
    100986279 (AXIN1)
   05213 Endometrial cancer
    100986279 (AXIN1)
   05224 Breast cancer
    100986279 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100986279 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100986279 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100986279 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100986279 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100986279 (AXIN1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100986279 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100986279
NCBI-ProteinID: XP_003809448
UniProt: A0A2R9AFS0
Position
16
AA seq 862 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTHRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDVSCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHIH
HSTARLKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGM
ACKRNAKKAESGKSTSTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR
ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPC
DSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDETVLPVFEEKIIGKVEKVD
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccgaggcccgcc
agctacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcactccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgctgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagaccgaaatccaggccactatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagcccgaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatatctggatacctgccgacc
ttaaatgaagatgaggaatggaagtgtgaccaggacatggacgaggacgatggcagagat
gctgctcctcccggaagactccctcagaagctgctcctggagacagctgccccgagggtc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctatgccctggccccagccaccagtgccaacgac
agcgagcagcagagcctgtccagcgatgcagacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaatgggcgggtgcccctacctcacattccccgcacgcaccgggtgccgaaggag
gtccgcgtggagcctcagaagttcgcggaggagctcatccaccgcctggaggccgtgcag
cgcacgcgggaggccgaggagaagctggaggagcggctgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcctcagggcccccagggccgtgtcacaagctgcctccc
gcccccgcttggcaccacttcccgccccgctgtgtggacgtgagctgtgccgggctccgg
gatgcacacgaggagaaccctgagagcatcctggacgagcacgtacagcgtgtgctgagg
acacctggccgccagtcgcctgggcctggccaccgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgctgcctcggggcacgggaagcacgtacccaagtca
ggggcgaagctggacgcggccggcctgcaccaccaccgacacgtccaccaccacatccac
cacagcacagcccggctcaaggagcaggtggaggccgaggccacccgcagggcccagagc
agcttcgcctggggcctggaaccacacagccatggggcaaggtcccgaggctactcagag
agcgtgggcgctgcccccaacgccagtgatggcctcgcccacagtgggaaggtgggcatg
gcgtgcaaaagaaatgccaagaaggctgagtcggggaagagcaccagcaccgaggttcca
ggtgcctcggaggatgcggagaagaaccagaaaatcatgcagtggatcattgagggggaa
aaggagatcagcaggcaccgcaggaccggccacgggtcttcggggacgaggaagccacag
ccccacgagaactccagacccttgtcccttgagcacccctgggccggccctcagctccgg
acctccgtgcagccctcccacctcttcatccaagaccccacgatgccaccccacccggct
cccaaccccctaacccagctggaggaggcgcgccgacgtctggaggaggaagaaaagaga
gccagccgagcaccctccaagcagaggtatgtgcaggaggttatgcggcggggacgtgcc
tgcgtcaggccagcgtgcgcgccggtgctgcacgtggtaccagccgtgtcggacatggag
ctctccgagacagagacaagatcgcagaggaaggtgggcggcgggagtgcccagccgtgt
gacagcatcgttgtggcgtactacttctgcggggaacccatcccctaccgcaccctggtg
aggggccgtgcggtcaccctgggccagttcaaggagctgctgaccaaaaagggcagctac
agatactacttcaagaaagtgagcgacgagtttgactgtggggtggtgtttgaggaggtt
cgagaggacgagaccgtcctgcccgtctttgaggagaagatcatcggcaaagtggagaag
gtggactga

KEGG   Pan paniscus (bonobo): 100990800
Entry
100990800         CDS       T02283                                 

Gene name
AXIN2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04310  Wnt signaling pathway
pps04390  Hippo signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04934  Cushing syndrome
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05213  Endometrial cancer
pps05217  Basal cell carcinoma
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100990800 (AXIN2)
   04390 Hippo signaling pathway
    100990800 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100990800 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100990800 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100990800 (AXIN2)
   05225 Hepatocellular carcinoma
    100990800 (AXIN2)
   05226 Gastric cancer
    100990800 (AXIN2)
   05217 Basal cell carcinoma
    100990800 (AXIN2)
   05213 Endometrial cancer
    100990800 (AXIN2)
   05224 Breast cancer
    100990800 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100990800 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100990800 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100990800 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100990800 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100990800 (AXIN2)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100990800 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100990800
NCBI-ProteinID: XP_008962981
UniProt: A0A2R9AXL2
Position
17
AA seq 843 aa
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHPKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgacttgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttattgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggccacggcgagt
gtgaggtccacggaaactgttgacagtggatataggtccttcaagaggagcgatcctgtt
aatccttatcacataggttctggctatgtctttgcgccagccaccagcgccaacgacagt
gagatatccagtgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggaaaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctcaggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagagtcctcaagacccctggctgccagtctccgggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcctggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaaaggctttgtgaccaagcagacgacaaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccaccccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacactctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcactcggccactgttcagacgggagccacacccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtatttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

DBGET integrated database retrieval system