KEGG   Pan paniscus (bonobo): 100986739
Entry
100986739         CDS       T02283                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04350  TGF-beta signaling pathway
pps04371  Apelin signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps04931  Insulin resistance
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05221  Acute myeloid leukemia
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100986739 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100986739 (RPS6KB2)
   04371 Apelin signaling pathway
    100986739 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100986739 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100986739 (RPS6KB2)
   04152 AMPK signaling pathway
    100986739 (RPS6KB2)
   04150 mTOR signaling pathway
    100986739 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100986739 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100986739 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100986739 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100986739 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100986739 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100986739 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100986739 (RPS6KB2)
   05205 Proteoglycans in cancer
    100986739 (RPS6KB2)
   05207 Chemical carcinogenesis - receptor activation
    100986739 (RPS6KB2)
   05231 Choline metabolism in cancer
    100986739 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100986739 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100986739 (RPS6KB2)
   05212 Pancreatic cancer
    100986739 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100986739 (RPS6KB2)
   05226 Gastric cancer
    100986739 (RPS6KB2)
   05221 Acute myeloid leukemia
    100986739 (RPS6KB2)
   05224 Breast cancer
    100986739 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100986739 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100986739 (RPS6KB2)
   05165 Human papillomavirus infection
    100986739 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100986739 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100986739 (RPS6KB2)
   01522 Endocrine resistance
    100986739 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100986739 (RPS6KB2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100986739 (RPS6KB2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100986739 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal ABC1 Seadorna_VP7
Other DBs
NCBI-GeneID: 100986739
NCBI-ProteinID: XP_003828769
UniProt: A0A2R8ZFT7
Position
11
AA seq 482 aa
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYMAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PISPLKFSPFEGFRPSPSLPEPTELPLPPVLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatttggatttggagacggaggaaggcagcgagggcgagggcgag
ccagagctcagccccgcggacgcgtgtccccttgccgagttgagggcagctggcctagag
cctgtgggacactatgaagaggtggagctgactgagaccagcgtgaaccttggcccagag
cgcatcgggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcaaggcaccaacttgggcaaaatatatgccatgaaagtc
ctaaggaaggccaaaattgtgcgcaatgccaaggacacagcacacacacgggctgagcgg
aacattctagagtcagtgaagcacccctttattgtggaactggcctatgccttccagact
ggtggcaaactctacctcatccttgagtgcctcagtggtggcgagctcttcacgcatctg
gagcgagagggcatcttcctggaagatacggcctgcttctacctggctgagatcacgctg
gccctgggccatctccactcccagggcatcatctaccgggacctcaagcccgagaacatc
atgctcagcagccagggccacatcaaactgaccgactttggactctgcaaggagtctatc
catgagggcgccgtcactcacaccttctgcggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagagaaccggaagaaaaccatggataag
atcatcaagggcaagctggcgctgcccccctaccttaccccagatgcccgggaccttgtc
aaaaagtttctgaaacggaatcccagccagcggattgggggtggcccaggggatgctgct
gatgtgcagagacatccctttttccggcacatgaattgggacgaccttctggcctggcgt
gtggacccccctttcaggccctgtctgcagtcagaggaggacgtgagccagtttgatacc
cgcttcacacggcagacgccggtggacagtcctgatgacacagccctcagcgagagtgcc
aaccaggccttcctgggcttcacatacatggcgccatctgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagtagcccccgggcc
cccatcagccccctcaagttctccccttttgaggggtttcgacccagccccagcctgccg
gagcccacggagctacctctacctccagtcctgccaccgccaccgccctcgaccaccgcc
cctctccccatccgtcccccctcagggaccaagaagtccaagaggggccgtgggcgtcca
gggcgctag

KEGG   Pan paniscus (bonobo): 100995177
Entry
100995177         CDS       T02283                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04350  TGF-beta signaling pathway
pps04371  Apelin signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps04931  Insulin resistance
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05221  Acute myeloid leukemia
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100995177 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100995177 (RPS6KB1)
   04371 Apelin signaling pathway
    100995177 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100995177 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100995177 (RPS6KB1)
   04152 AMPK signaling pathway
    100995177 (RPS6KB1)
   04150 mTOR signaling pathway
    100995177 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100995177 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100995177 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100995177 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100995177 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100995177 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100995177 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995177 (RPS6KB1)
   05205 Proteoglycans in cancer
    100995177 (RPS6KB1)
   05207 Chemical carcinogenesis - receptor activation
    100995177 (RPS6KB1)
   05231 Choline metabolism in cancer
    100995177 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995177 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100995177 (RPS6KB1)
   05212 Pancreatic cancer
    100995177 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100995177 (RPS6KB1)
   05226 Gastric cancer
    100995177 (RPS6KB1)
   05221 Acute myeloid leukemia
    100995177 (RPS6KB1)
   05224 Breast cancer
    100995177 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100995177 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100995177 (RPS6KB1)
   05165 Human papillomavirus infection
    100995177 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100995177 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100995177 (RPS6KB1)
   01522 Endocrine resistance
    100995177 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995177 (RPS6KB1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100995177 (RPS6KB1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100995177 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal ABC1 APH
Other DBs
NCBI-GeneID: 100995177
NCBI-ProteinID: XP_014197642
Position
17
AA seq 504 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQ
FDSKFTRQTPXXXXXQNAILXSTVTVFQGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGS
PRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQP
NSGPYKKQAFPMISKRPEHLRMNL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagccccggacttccgagacagggaa
gctgaggacatggcaggagtgttcgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaaggctcatccattctttagacacattaactgggaagaacttctg
gctcgaaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagtcag
tttgattccaagtttacacgtcagacacctnnnnnnnnnnnnngacaaaatgccattctg
tagtccactgttactgtctttcagggttttacatatgtggctccatctgtacttgaaagt
gtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggcagc
ccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggtgct
tcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggcata
gagcagatggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacagccg
aactctgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcacctg
cgtatgaatctatga

DBGET integrated database retrieval system