KEGG   Pan paniscus (bonobo): 100988020
Entry
100988020         CDS       T02283                                 

Gene name
PLCZ1
Definition
(RefSeq) phospholipase C zeta 1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04114  Oocyte meiosis
pps04919  Thyroid hormone signaling pathway
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100988020 (PLCZ1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100988020 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100988020 (PLCZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100988020 (PLCZ1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100988020 (PLCZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100988020 (PLCZ1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100988020 (PLCZ1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100988020 (PLCZ1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_7 EF-hand_10 EF-hand_6
Other DBs
NCBI-GeneID: 100988020
NCBI-ProteinID: XP_008967828
Position
12
AA seq 643 aa
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECGKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETRERKGSDKRGKVEEWEEEVADGEEEEEEEEEEKFKESEVLESVLGDNQDKETG
VKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQAR
KLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQ
NGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEDMPITLTIRLISGIQLPLTHSSSNKGD
SLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVESQGLIAGN
EFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggaaatgagatggtttttgtcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagcaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgcctactgtttaaaaatgaatgtggaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattattg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaaccactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacgcgtgaaagaaaaggttctgataagcgtggtaaggtggag
gaatgggaagaagaagtggcagatggagaggaggaggaggaggaggaggaggaggagaaa
ttcaaagaatcagaagtattggaatctgttttaggagacaatcaagacaaggaaacaggg
gtaaaaaagttacctggagtaatgcttttcaagaaaaagaagaccaggaagctaaaaatt
gctctggctttatctgatcttgtcatttatacgaaagctgagaagttcaaaagctttcaa
cattcaagattatatcagcaatttaatgaaaataattctattggggagacacaagcccga
aaactttcaaaattgcgagtccatgagtttatttttcacaccaggaagttcattaccaga
atatatcccaaagcaacaagagcagactcttctaattttaatccccaagaattttggaat
ataggttgtcaaatggtggctttaaatttccagacccctggtctgcctatggatctgcaa
aatgggaaatttttggataatggtggttctggatatattttgaaaccacatttcttaaga
gagagtaaatcatactttaacccaagtaacataaaagaggatatgccaattacacttaca
ataaggctcatcagtggtatccagttgcctcttactcattcatcatctaacaaaggtgat
tcattagtaattatagaagtttttggtgttccaaatgatcaaatgaagcagcagactcgt
gtaattaaaaaaaatgcttttagtccaagatggaatgaaacattcacatttattattcat
gtcccagaattggcattgatacgttttgttgttgaaagtcaaggtttaatagcaggaaat
gaatttcttgggcaatatactttgccacttctatgcatgaacaaaggttatcgtcgtatt
cctctgttttccagaatgggtgagagccttgagcctgcttcactgtttgtttatgtttgg
tacgtcagataa

DBGET integrated database retrieval system