KEGG   Pan paniscus (bonobo): 100988665
Entry
100988665         CDS       T02283                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04140  Autophagy - animal
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04722  Neurotrophin signaling pathway
pps04910  Insulin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05165  Human papillomavirus infection
pps05168  Herpes simplex virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05207  Chemical carcinogenesis - receptor activation
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100988665 (BAD)
   04014 Ras signaling pathway
    100988665 (BAD)
   04370 VEGF signaling pathway
    100988665 (BAD)
   04024 cAMP signaling pathway
    100988665 (BAD)
   04022 cGMP-PKG signaling pathway
    100988665 (BAD)
   04151 PI3K-Akt signaling pathway
    100988665 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100988665 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100988665 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100988665 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100988665 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100988665 (BAD)
   04919 Thyroid hormone signaling pathway
    100988665 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100988665 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988665 (BAD)
   05207 Chemical carcinogenesis - receptor activation
    100988665 (BAD)
   05203 Viral carcinogenesis
    100988665 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100988665 (BAD)
   05212 Pancreatic cancer
    100988665 (BAD)
   05225 Hepatocellular carcinoma
    100988665 (BAD)
   05221 Acute myeloid leukemia
    100988665 (BAD)
   05220 Chronic myeloid leukemia
    100988665 (BAD)
   05218 Melanoma
    100988665 (BAD)
   05211 Renal cell carcinoma
    100988665 (BAD)
   05215 Prostate cancer
    100988665 (BAD)
   05213 Endometrial cancer
    100988665 (BAD)
   05223 Non-small cell lung cancer
    100988665 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100988665 (BAD)
   05161 Hepatitis B
    100988665 (BAD)
   05160 Hepatitis C
    100988665 (BAD)
   05162 Measles
    100988665 (BAD)
   05168 Herpes simplex virus 1 infection
    100988665 (BAD)
   05165 Human papillomavirus infection
    100988665 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100988665 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100988665 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100988665 (BAD)
   05014 Amyotrophic lateral sclerosis
    100988665 (BAD)
   05020 Prion disease
    100988665 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100988665 (BAD)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100988665 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100988665 (BAD)
   01524 Platinum drug resistance
    100988665 (BAD)
   01522 Endocrine resistance
    100988665 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100988665
NCBI-ProteinID: XP_003828614
UniProt: A0A2R8Z688
Position
11
AA seq 168 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacgggccctcgggctccagcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcg
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcag
atgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system