KEGG   Pan paniscus (bonobo): 100989209
Entry
100989209         CDS       T02283                                 

Gene name
TRADD
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04071  Sphingolipid signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04622  RIG-I-like receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04668  TNF signaling pathway
pps04920  Adipocytokine signaling pathway
pps05132  Salmonella infection
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100989209 (TRADD)
   04064 NF-kappa B signaling pathway
    100989209 (TRADD)
   04668 TNF signaling pathway
    100989209 (TRADD)
   04071 Sphingolipid signaling pathway
    100989209 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100989209 (TRADD)
   04217 Necroptosis
    100989209 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100989209 (TRADD)
   04657 IL-17 signaling pathway
    100989209 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100989209 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100989209 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100989209 (TRADD)
   05160 Hepatitis C
    100989209 (TRADD)
   05164 Influenza A
    100989209 (TRADD)
   05162 Measles
    100989209 (TRADD)
   05168 Herpes simplex virus 1 infection
    100989209 (TRADD)
   05163 Human cytomegalovirus infection
    100989209 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100989209 (TRADD)
   05169 Epstein-Barr virus infection
    100989209 (TRADD)
   05165 Human papillomavirus infection
    100989209 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100989209 (TRADD)
   05152 Tuberculosis
    100989209 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 100989209
NCBI-ProteinID: XP_014197275
Position
16
AA seq 312 aa
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYRXGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgctttctccgcgcctaccgcnagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggcctcaaatggcgcaaggtggggcgttcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system