KEGG   Pan paniscus (bonobo): 100989555
Entry
100989555         CDS       T02283                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04071  Sphingolipid signaling pathway
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04932  Non-alcoholic fatty liver disease
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100989555 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100989555 (BID)
   04215 Apoptosis - multiple species
    100989555 (BID)
   04217 Necroptosis
    100989555 (BID)
   04115 p53 signaling pathway
    100989555 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100989555 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100989555 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100989555 (BID)
   05161 Hepatitis B
    100989555 (BID)
   05160 Hepatitis C
    100989555 (BID)
   05164 Influenza A
    100989555 (BID)
   05162 Measles
    100989555 (BID)
   05168 Herpes simplex virus 1 infection
    100989555 (BID)
   05163 Human cytomegalovirus infection
    100989555 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100989555 (BID)
   05169 Epstein-Barr virus infection
    100989555 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100989555 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100989555 (BID)
   05014 Amyotrophic lateral sclerosis
    100989555 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100989555 (BID)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100989555 (BID)
   05416 Viral myocarditis
    100989555 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100989555 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100989555 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C
Other DBs
NCBI-GeneID: 100989555
NCBI-ProteinID: XP_003828341
UniProt: A0A2R9A786
Position
22
AA seq 241 aa
MCSGAGVMMARWAARGRAGCRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSGLRDE
CITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEA
DSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQL
LQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGM
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtgcagcggggctggggtcatgatggctcggtgggcagcgaggggccgggccggctgc
aggagcacagtgcggattctgtcgccactgggacactgtgaaccaggagtgagtcggagc
tgccgcgctgcccaggccatggactgtgaggtcaacaacggttccggcctcagggatgag
tgcatcacaaacctactggtgtttggcttcctccaaagctgctctgacaacagcttccgc
agagagctggatgcactgggccacgagctgccagtgctggctccccagtgggagggctac
gatgagctgcagactgacggcaaccgcagcagccactcccgcttgggaagaatagaggca
gattctgaaagtcaagaagacatcatccggaatattgccaggcacctcgcccaggtcggg
gacagcatggaccgtagcatccctccgggcctggtgaacggcctggccctgcagctcagg
aacaccagccggtcggaggaggaccggaacagggacctggccactgccctggagcagctg
ctgcaggcctaccctagagacatggagaaggagaagaccatgctggtgctggccctgctg
ctggccaagaaggtggccagtcacacgccgtccttgctccgtgatgtctttcacacaaca
gtgaattttattaaccagaacctacgcacctacgtgaggagcttagccagaaatgggatg
gactga

DBGET integrated database retrieval system