KEGG   Pan paniscus (bonobo): 100990265
Entry
100990265         CDS       T02283                                 

Gene name
MCU
Definition
(RefSeq) mitochondrial calcium uniporter
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04218  Cellular senescence
pps04621  NOD-like receptor signaling pathway
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05017  Spinocerebellar ataxia
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100990265 (MCU)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100990265 (MCU)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100990265 (MCU)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100990265 (MCU)
   05012 Parkinson disease
    100990265 (MCU)
   05014 Amyotrophic lateral sclerosis
    100990265 (MCU)
   05017 Spinocerebellar ataxia
    100990265 (MCU)
   05020 Prion disease
    100990265 (MCU)
   05022 Pathways of neurodegeneration - multiple diseases
    100990265 (MCU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100990265 (MCU)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100990265 (MCU)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    100990265 (MCU)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100990265 (MCU)
SSDB
Motif
Pfam: MCU SPX
Other DBs
NCBI-GeneID: 100990265
NCBI-ProteinID: XP_003816026
Position
10
AA seq 346 aa
MAAAAGRSLLLLLSSRGGGGGGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVY
CSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRV
AIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQ
LYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMAT
QFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHK
GAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggccgccgcaggtagatcgctcctgctgctcctctcctctcggggcggcggcggt
ggcggggcgctgactgccggctgcttccctgggctgggcgtcagccgccaccggcagcag
cagcaccaccggacggtacaccagaggatcgcttcctggcagaatttgggagctgtttat
tgcagtactgttgtgccctctgatgatgttacagtggtttatcaaaatgggttacctgtg
atatctgtgaggctaccatcccggcgtgaacgctgtcagttcacactcaagcctatctct
gactctgttggtgtatttttacgacaactgcaagaagaggatcggggaattgacagagtt
gctatctattcaccagatggtgttcgcgttgctgcttcaacaggaatagacctcctcctc
cttgatgactttaagctggtcattaatgacttaacatatcacgtacgaccaccaaaaaga
gacctcttaagtcatgaaaatgcagcaacgctgaatgatgtaaagacattggtccagcaa
ctatacaccacactgtgcattgagcagcaccagttaaacaaggaaagggagcttattgaa
agactagaggatctcaaagagcagctggctcccctggaaaaggtacgaattgagattagc
agaaaagctgagaagaggaccactttggtgctatggggtggccttgcctacatggccaca
cagtttggcattttggcccggcttacctggtgggaatattcctgggacatcatggagcca
gtaacatacttcatcacttatggaagtgccatggcaatgtatgcatattttgtaatgaca
cgccaggaatatgtttatccagaagccagagacagacaatacttactatttttccataaa
ggagccaaaaagtcacgttttgacctagagaaatacaatcaactcaaggatgcaattgct
caggcagaaatggaccttaagagactgagagacccattacaagtacatctgcctctccga
caaattggtgaaaaagattga

DBGET integrated database retrieval system