KEGG   Pan paniscus (bonobo): 100991127
Entry
100991127         CDS       T02283                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04310  Wnt signaling pathway
pps04350  TGF-beta signaling pathway
pps04371  Apelin signaling pathway
pps04390  Hippo signaling pathway
pps04520  Adherens junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04659  Th17 cell differentiation
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05220  Chronic myeloid leukemia
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100991127 (SMAD4)
   04350 TGF-beta signaling pathway
    100991127 (SMAD4)
   04390 Hippo signaling pathway
    100991127 (SMAD4)
   04371 Apelin signaling pathway
    100991127 (SMAD4)
   04068 FoxO signaling pathway
    100991127 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100991127 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100991127 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100991127 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100991127 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991127 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100991127 (SMAD4)
   05212 Pancreatic cancer
    100991127 (SMAD4)
   05225 Hepatocellular carcinoma
    100991127 (SMAD4)
   05226 Gastric cancer
    100991127 (SMAD4)
   05220 Chronic myeloid leukemia
    100991127 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991127 (SMAD4)
   05161 Hepatitis B
    100991127 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100991127 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100991127
NCBI-ProteinID: XP_008950853
UniProt: A0A2R9A0M1
Position
18
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcgtcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcaacagcaggcggctactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cataccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system