KEGG   Pan paniscus (bonobo): 100991913
Entry
100991913         CDS       T02283                                 

Gene name
TNFRSF11A
Definition
(RefSeq) TNF receptor superfamily member 11a
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04064  NF-kappa B signaling pathway
pps04380  Osteoclast differentiation
pps04917  Prolactin signaling pathway
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100991913 (TNFRSF11A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100991913 (TNFRSF11A)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100991913 (TNFRSF11A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100991913 (TNFRSF11A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100991913 (TNFRSF11A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100991913 (TNFRSF11A)
   04090 CD molecules [BR:pps04090]
    100991913 (TNFRSF11A)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100991913 (TNFRSF11A)
CD molecules [BR:pps04090]
 Proteins
  100991913 (TNFRSF11A)
SSDB
Motif
Pfam: RANK_CRD_2 TNFR_c6 DAG1
Other DBs
NCBI-GeneID: 100991913
NCBI-ProteinID: XP_003827371
Position
18
AA seq 721 aa
MQAEGDWYKETDPGQSNGKLSPSMWDSRQSLGIRSKERASLACSVKGTSRSVLRSDILNG
HQGLEPRTQLVTSDSAPKQLLQGYPIYQIPLKNGQIQKLVFVLESYPFEPEGNQRLRKLK
QLLQSFRQQVALQIVPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEY
LDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPG
LGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDVVCSS
SLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWINEACGR
LSGDKESSGDSCVSTHTADFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGG
PYAQGEDARMLSLVSETEIEEDSFRQMPTEDEYMDRPSQPTDRLLFLTEPGSKSTPPFSE
PLEVGENDSLSQCFTGTQSTVGSESCNCTEPPCRTDWTPVSSENYLQKEVDSGHCPHWAA
SPSPNWADVCTGCRNPPGEDCEPLVGSPKCGPLPQCAYGMGLPPEEEAGRTEARDQPEDG
ADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQ
EGAAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAK
A
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgcaggcagagggagactggtataaggaaacagatccagggcagtctaacgggaaactg
agcccaagcatgtgggactcaagacagagtctggggatcaggagcaaggagagagccagt
ctggcctgcagcgtcaaggggacaagtcggtcagtcctcaggtcagatatactcaatggg
caccagggcttggagcccaggacacagcttgtgacatctgacagtgcccctaagcagcta
cttcagggatatcccatttaccaaattcccctaaaaaatgggcagattcagaaattggta
tttgtcttagaatcatacccttttgaaccagaagggaaccagaggctgaggaagcttaaa
cagctcctgcagtccttcaggcaacaggtggctttgcagatcgttcctccgtgtaccagt
gagaagcattatgagcatctgggacggtgctgtaacaaatgtgaaccaggaaagtacatg
tcttctaaatgcactactacctctgacagtgtatgtctgccctgtggcccggatgaatac
ttggatagctggaatgaagaagataaatgcttgctgcataaagtttgtgatacaggcaag
gccctggtggccgtggtcgccggcaacagcacgaccccccggcgctgcgcgtgcacggct
gggtaccactggagccaggactgcgagtgctgccgccgcaacaccgagtgcgcgccgggc
ctgggcgcccagcacccgttgcagctcaacaaggacacggtgtgcaaaccttgccttgca
ggctacttctctgatgccttttcctccacggacaaatgcagaccctggaccaactgtacc
ttccttggaaagagagtagaacatcatgggacagagaaatccgatgtggtttgcagttct
tctctgccagctagaaaaccaccaaatgaaccccatgtttacttgcccggtttaataatt
ctgcttctcttcgcgtctgtggccctagtggctgccatcatctttggcgtttgctatagg
aaaaaagggaaagcactcacagccaatttgtggcactggatcaatgaggcttgtggccgc
ctaagtggagataaggagtcctcaggtgacagttgtgtcagtacacacacggcagacttt
ggtcagcagggagcatgtgaaggtgtcttactgctgactctggaggagaagacatttcca
gaagatatgtgctacccagatcaaggtggtgtctgtcagggcacgtgtgtaggaggtggt
ccctacgcacaaggcgaagatgccaggatgctctcattggtcagcgagaccgagatagag
gaagacagcttcagacagatgcccacggaagatgaatacatggacaggccctcccagccc
acagaccggttactgttcctcactgagcctggaagcaaatccacacctcctttctctgaa
cccctggaggtgggggagaatgacagtttaagccagtgcttcacggggacacagagcaca
gtgggttcagaaagctgcaactgcactgagcccccatgcaggactgattggacgcccgtg
tcctctgaaaactacttgcaaaaagaggtggacagtggccattgcccgcactgggcagcc
agccccagccccaactgggcagatgtctgcacaggctgccggaaccctcctggggaggac
tgtgaacccctcgtgggttccccaaaatgtggacccttgccccagtgcgcctatggcatg
ggccttccgcctgaagaagaagccggcaggacggaggccagagaccagcccgaggatggg
gctgatgggaggctcccaagctcagcgagggcaggtgccgggtctggaagctcccctggt
ggccagtcccctgcatctggaaatgtgactggaaacagtaactccacgttcatctccagc
gggcaggtgatgaacttcaagggcgacatcatcgtggtctacgtcagccagacctcgcag
gagggcgcggcggcggctgctgcggagcccatgggccgcccggtgcaggaggagaccctg
gcgcgccgcgactccttcgcggggaacggcccgcgcttcccggacccgtgcggcggcccc
gaggggctgcgggagccggagaaggcctcgaggccggtgcaggagcaaggcggggccaag
gcttga

DBGET integrated database retrieval system