KEGG   Pan paniscus (bonobo): 100991936
Entry
100991936         CDS       T02283                                 

Gene name
PTK2B
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04670  Leukocyte transendothelial migration
pps04912  GnRH signaling pathway
pps05135  Yersinia infection
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100991936 (PTK2B)
   04072 Phospholipase D signaling pathway
    100991936 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100991936 (PTK2B)
   04670 Leukocyte transendothelial migration
    100991936 (PTK2B)
   04062 Chemokine signaling pathway
    100991936 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100991936 (PTK2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100991936 (PTK2B)
   05161 Hepatitis B
    100991936 (PTK2B)
   05163 Human cytomegalovirus infection
    100991936 (PTK2B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100991936 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991936 (PTK2B)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100991936 (PTK2B)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  FAK family
   100991936 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100991936
NCBI-ProteinID: XP_008954484
UniProt: A0A2R9BL74
Position
8
AA seq 1009 aa
MSGVSEPLSRIKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHLRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagccgaataaagttgggcacgttacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaggacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaagaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatt
gggcccaacatccagttggctgagtgctatgggctgaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccagaagacttc
atggagagcctgaaggaggacaggaccacgctgctctatttttaccaacagctccggaac
gactacatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgccggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccgctggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcatccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggggagcaccaaggc
tctctcatcatccatcttaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacctctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcccggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaatgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgccgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggagaccggctgcccaagcctgatctctgtccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacgtttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacagccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccacaaaccaacctcctggctccaaagctgcagttccaggttccc
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aaggtcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacctggagttcacagggcccccacagaagcccccg
aggctgggcgcacagtccatccagcccacagctaacctggaccggaccgatgacctggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctacgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagtgtggatgatctcctgccttccttgccgtcatcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggct
cagcagaacgccgtgacatccctgagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggctgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

DBGET integrated database retrieval system