KEGG   Pan paniscus (bonobo): 100992569
Entry
100992569         CDS       T02283                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05207  Chemical carcinogenesis - receptor activation
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100992569 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100992569 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100992569 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100992569 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100992569 (IKBKE)
   04657 IL-17 signaling pathway
    100992569 (IKBKE)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100992569 (IKBKE)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100992569 (IKBKE)
   05160 Hepatitis C
    100992569 (IKBKE)
   05171 Coronavirus disease - COVID-19
    100992569 (IKBKE)
   05164 Influenza A
    100992569 (IKBKE)
   05162 Measles
    100992569 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100992569 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100992569 (IKBKE)
   05169 Epstein-Barr virus infection
    100992569 (IKBKE)
   05165 Human papillomavirus infection
    100992569 (IKBKE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100992569 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100992569 (IKBKE)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100992569 (IKBKE)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100992569 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like zf-RING_9 RIO1 DUF5798
Other DBs
NCBI-GeneID: 100992569
NCBI-ProteinID: XP_003822972
UniProt: A0A2R9BQ59
Position
1
AA seq 716 aa
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIIKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcagagcacagccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggagagctggttgctgtgaaggtcttc
aacactaccagctacctgcggccccgtgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacatcatcaagctctttgcggtggaggagacgggcggaagccgg
cagaaggtactggtgatggagtactgctccagtgggagtctgctgagtgtgctggagagc
cctgagaatgcctttgggctgcctgaggatgagttcctggtggtgctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcattgtgcatcgcgacatcaagcccgggaac
atcatgcgcctcgtaggggaggaggggcagagcatttacaagctgacagacttcggggct
gcccgggagctggatgatgatgagaagttcgtctcggtctatgggactgaggagtacctg
catcctgacatgtatgagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtg
actgtggatctctggagcattggagtgaccttgtaccatgcagccactggcagcctgccc
ttcatcccctttggtgggccacggcggaacaaggagatcatgtaccggatcaccacggag
aagccggctggggccattgcaggtgcccagaggcgggagaacgggcccctggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtc
ctgcaccacatctatatccatgcccacaacacgatagccattttccaggaggccgtgcac
aagcagaccagtgtggccccccggcaccaggagtacctctttgagggtcacctctgtgtc
ctcgagcccagcgtctcagcacagcacatcgcccacacgacggcaagcagccccctgacc
ctcttcagcacagccatccctaaggggctggccttcagggaccctgctctggacgtcccc
aagttcgtccccaaagtggacctgcaggcggattacaacactgccaagggcgtgttgggc
gccggctaccaggccctgcggctggcacgggccctgctggatgggcaggagctaatgttt
cgggggctgcactgggtcatggaggtgctccaggccacatgcagacggactctggaagtg
gcaaggacatccctcctctacctcagcagcagcctgggaactgaaaggttcagcagcgtg
gctggaacgcctgagattcaggaactgaaggcggccgcagaactgaggtccaggctgcgg
actctagctgaggtcctctccagatgctcccaaaatatcacggagacccaggagagcctg
agcagcctgaaccgggagctggtgaagagccgggatcaggtacatgaggacagaagcatc
cagcagattcagtgctgtttggacaagatgaacttcatctacaaacagttcaagaagtct
aggatgaggccagggcttggctacaacgaggagcagattcacaagctggataaggtgaat
ttcagtcatttagccaaaagactcctgcaggtgttccaggaggagtgcgtgcagaagtat
caagcatccttagtcacacacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggtcggctgttctgtggctgcctgtaacacagaagcccagggggtccaggaa
agtctcagcaagctcctggaagagctatctcaccagctccttcaggaccgagcaaagggg
gctcaggcctcgccacctcccatagctccttaccccagccctacacgaaaggacctgctt
ctccacatgcaagagctctgtgaggggatgaagctgctggcatctgacctcctggacaac
aaccgcatcatcgaacggctaaatagagtcccagcacctcctgatgtctga

DBGET integrated database retrieval system