KEGG   Pan paniscus (bonobo): 100994342
Entry
100994342         CDS       T02283                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04066  HIF-1 signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05200  Pathways in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100994342 (IFNGR1)
   04066 HIF-1 signaling pathway
    100994342 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100994342 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100994342 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100994342 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    100994342 (IFNGR1)
   04659 Th17 cell differentiation
    100994342 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100994342 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100994342 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100994342 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    100994342 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    100994342 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100994342 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100994342 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100994342 (IFNGR1)
   05140 Leishmaniasis
    100994342 (IFNGR1)
   05142 Chagas disease
    100994342 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100994342 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100994342 (IFNGR1)
   04090 CD molecules [BR:pps04090]
    100994342 (IFNGR1)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IFN receptor family
   100994342 (IFNGR1)
CD molecules [BR:pps04090]
 Proteins
  100994342 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100994342
NCBI-ProteinID: XP_003827746
UniProt: A0A2R9AUN0
Position
6
AA seq 489 aa
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDELQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVAPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRSGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctctcctctttctcctaccccttgtcatgcagggtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctacaccaactaatgttacaattgaatcctat
aacatgaaccctatcgtatattgggagtaccagatcatgccacaggtccctgtttttacc
gtagaggtaaagaactatggtgttaagaattcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcagaagaatttgct
gtatgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacatatttcacccttcagtttttgtaaatggagacgagcaggaagtcgat
tatgatcccgaaactacctgttacattagggtgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgtgacgagcttcagtgc
cagttagcgattccagtatcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtatggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagcataaaaggttctctttggattccagttgttgctgctttactactctttctagtg
cttagcctggtattcatctgtttttatattaagaagattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttagaaacaaaacct
gaatcaaaatatgtatcactcatcacgtcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtggaacatacagaagaactttctagtataacagaagtggtgactactgaagaa
aatattcctgacgtggccccgggcagccatctgactccaatagagagagagagttcttca
cctttaagtagtaaccagtctgaacctggcagcatcgctttaaactcgtatcactccaga
aattgttctgagagtgatcactccagaagtggttttgatactgattccagctgtctggaa
tcacatagctccttatctgactcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataaccgtaataaaagcccccacctcctttggttatgataaacca
catgtgctagtggatctacttgtggatgatagcggtaaagagtccttgattggttataga
ccaacagaagattccaaagaattttcatga

DBGET integrated database retrieval system