KEGG   Pan paniscus (bonobo): 100995446
Entry
100995446         CDS       T02283                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100995446 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100995446 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100995446 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100995446 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100995446 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100995446 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100995446 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100995446 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995446 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100995446 (IFNAR1)
   05160 Hepatitis C
    100995446 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100995446 (IFNAR1)
   05164 Influenza A
    100995446 (IFNAR1)
   05162 Measles
    100995446 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100995446 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995446 (IFNAR1)
   05169 Epstein-Barr virus infection
    100995446 (IFNAR1)
   05165 Human papillomavirus infection
    100995446 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100995446 (IFNAR1)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IFN receptor family
   100995446 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 fn3_4
Other DBs
NCBI-GeneID: 100995446
NCBI-ProteinID: XP_003824035
UniProt: A0A2R8ZEG7
Position
21
AA seq 558 aa
MMVALLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKPGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPPGTKDSVMWALDGLSFTYSLVIWKNSSGVEER
IENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSV
QNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQ
KGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNT
PVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSS
VFSDVVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSNID
EYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYS
NEDESESKTSEELQQDFV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgatggtcgccctcctgggcgcgacgaccctagtgctcgtcgccgtggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggtcgacatc
atagatgacaactttatcctgaggtggaacaggagcgatgagtctgtcgggaatgtgact
ttttcattcgattatcaaaaacctgggatggataattggataaaattgtctgggtgtcag
aatattactagtaccaaatgcaacttttcttcactcaagctgaatgtttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcaaattggtcctccagaagtacatttagaagctgaagataag
gcaatagtgatacacatctctcctcctggaacaaaagatagtgttatgtgggctttggat
ggtttaagctttacatatagcttagttatctggaaaaactcttcaggtgtagaagaaagg
attgaaaatatttattccagacataaaatttataaactctcaccagagactacttattgt
ctaaaagttaaagcagcactacttacgtcatggaaaattggtgtctatagtccagtacat
tgtataaagaccacagttgaaaatgaactacctccaccagaaaatatagaagtcagtgtc
caaaatcagaactatgttcttaaatgggattatacatatgcaaacatgacctttcaagtt
cagtggctccacgcctttttaaaaaggaatcctggaaaccatttgtataaatggaaacaa
atacctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaacgttttccaa
aaaggaatttaccttctccgcgtacaagcatctgatggaaataacacatctttttggtct
gaagagataaagtttgatactgaaatacaagctttcctacttcctccagtctttaacatt
agatcccttagtgattcattccatatctatatcggtgctccaaaacagtctggaaacacg
cctgtgatccaggattatccactgatttatgaaattattttttgggaaaacacttcaaat
gctgagagaaaaattatcgagaaaaaaactgatgttacagttcctaatttgaaaccactg
actgtatattgtgtgaaagccagagcacacaccatggatgaaaagctgaataaaagcagt
gtttttagtgacgttgtgtgtgagaagacaaaaccaggaaatacctctaaaatttggctt
atagttggaatttgtattgcattatttgctctcccgtttgtcatttatgctgcgaaagtc
ttcttgagatgcatcaattatgtcttctttccatcacttaaaccttcttccaatatagat
gagtatttctctgaacagccattgaagaatcttctgctttcaacttctgaggaacaaatc
gaaaaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcaa
actgatgaagatcataaaaaatacagttcccaaactagccaagattcaggaaattattct
aatgaagatgaaagcgaaagtaaaacaagtgaagaactacagcaggactttgtatga

KEGG   Pan paniscus (bonobo): 100995792
Entry
100995792         CDS       T02283                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps05160  Hepatitis C
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100995792 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    100995792 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100995792 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100995792 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100995792 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    100995792 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    100995792 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100995792 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995792 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100995792 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    100995792 (IFNAR2)
   05164 Influenza A
    100995792 (IFNAR2)
   05162 Measles
    100995792 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    100995792 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995792 (IFNAR2)
   05169 Epstein-Barr virus infection
    100995792 (IFNAR2)
   05165 Human papillomavirus infection
    100995792 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100995792 (IFNAR2)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IFN receptor family
   100995792 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100995792
NCBI-ProteinID: XP_014198678
UniProt: A0A2R9B318
Position
21
AA seq 516 aa
MLLSQNAFIVRSLNLVLMVYISLVFGISHDSPDYTDESCTFKISLRNFRSILSWELKNHS
IVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTILEGFSGNTTLF
SCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKK
HKPEIKGNLSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAE
SAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLNFHNFLAWPFPNLPPLEAMD
MVEVIYINRKKKVWDYNYDDESDSDTEAAHRTSGGGYTMHGLTVRPLGQASATSTESQLI
DPESEEEPDLPEVDVELPTMPKDSPQQLELLSGPCERRKSPLQDPFPEEDYSSTEGSGGR
ITFNVDLNSVFLRVLDDEDSDDLEEAPLMLSSHLEEMVDPEDPDNVQSNHLLASGEGTQP
TFPSPSSEGLWSEDAPSDQSDTSESDVDLGDGYIMR
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgccttcatcgtcagatcacttaatttggttctcatggtgtat
atcagcctcgtgtttggtatttcacatgattcgcctgattacacagatgaatcttgcact
ttcaagatatcattgcgaaatttccggtccatcttatcatgggaattaaaaaaccactcc
attgtaccaactcactatacattgctgtatacaatcatgagtaaaccagaagatttgaag
gtggttaagaactgtgcaaataccacaagatcattttgtgacctcacagatgagtggaga
agcacacacgaggcctatgtcaccatcctagaaggattcagcgggaacacaacgttgttc
agttgctcacacaatttctggctggccatagacatgtcttttgaaccaccagagtttgag
attgttggttttaccaaccacattaatgtgatggtgaaatttccatctattgttgaggaa
gaattacagtttgatttatctctcgtcattgaagaacagtcagagggaattgttaagaag
cataaacccgaaataaaagggaacctgagtggaaatttcacctatatcattgacaagtta
attccaaacacgaactactgtgtatctgtttatttagagcacagtgatgagcaagcagta
ataaagtctcccttaaaatgcaccctccttccacctggccaggaatcagaatcagcagaa
tctgccaaaataggaggaataattactgtgtttttgatagcattggtcttgacaagcacc
atagtgacactgaaatggattggttatatatgcttaagaaacagcctccccaaagtcttg
aattttcataactttttagcctggccatttcctaacctgccaccgttggaagccatggat
atggtggaggtcatttacatcaacagaaagaagaaagtgtgggattataattatgatgat
gaaagtgatagcgatactgaggcagcgcacaggacaagtggcggtggctataccatgcat
ggactgactgtcaggcctctgggtcaggcctctgccacctctacagaatcccagttgata
gacccggagtccgaggaggagcctgacctgcctgaggttgatgtggagctccccacgatg
ccaaaggacagccctcagcagttggaactcttgagtgggccctgtgagaggagaaagagt
ccactccaggacccttttcccgaagaggactacagctccacggaggggtctgggggcaga
attaccttcaatgtggatttaaactctgtgtttttgagagttcttgatgacgaggacagt
gacgacttagaagaagcccctctgatgctatcgtctcatctggaagagatggttgaccca
gaggatcctgataatgtgcaatcaaaccatttgctggccagcggggaagggacacagcca
acctttcccagcccctcttcagagggcctgtggtccgaagatgctccatctgatcaaagt
gacacttctgagtcagatgttgaccttggggatggttatataatgagatga

DBGET integrated database retrieval system