KEGG   Pan paniscus (bonobo): 100995524
Entry
100995524         CDS       T02283                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05134  Legionellosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05222  Small cell lung cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100995524 (APAF1)
   04215 Apoptosis - multiple species
    100995524 (APAF1)
   04115 p53 signaling pathway
    100995524 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995524 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100995524 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100995524 (APAF1)
   05160 Hepatitis C
    100995524 (APAF1)
   05164 Influenza A
    100995524 (APAF1)
   05162 Measles
    100995524 (APAF1)
   05168 Herpes simplex virus 1 infection
    100995524 (APAF1)
   05169 Epstein-Barr virus infection
    100995524 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100995524 (APAF1)
   05152 Tuberculosis
    100995524 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100995524 (APAF1)
   05012 Parkinson disease
    100995524 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100995524 (APAF1)
   05016 Huntington disease
    100995524 (APAF1)
   05020 Prion disease
    100995524 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100995524 (APAF1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995524 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100995524 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD WD40_like Ge1_WD40 CARD_2 eIF2A AAA_16 NACHT AAA_22 Cactin_mid AAA_18
Other DBs
NCBI-GeneID: 100995524
NCBI-ProteinID: XP_003832654
UniProt: A0A2R9AJS4
Position
12
AA seq 1205 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNSEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLWNIDSRSKVADCRGHLS
WVHGVMFSPDGSSFLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHI
RRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHK
KTVWHIQFTADEKTLISSSDDSEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSF
DGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHEL
RGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDL
CFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYI
LQTLE
NT seq 3618 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatgattcctacgtatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcgtatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgtcacaaggaagaagctggtgaatgcaattcagcagaagctc
tccaaattgaaaggtgaaccaggatgggtcaccatacatggaatggcaggctgtgggaag
tctgtattagctgcagaagctgttagagatcattcccttttagaaggttgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagacaaatctgggcttctgatgaaactgcag
aatctttgcacacggttggatcaggatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctcatgcttcgcaaacacccaaggtctctcttg
atcttggatgatgtttgggactcttgggtgttgaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgtcacagattcagtaatgggtcctaaatatgtagtc
cctgtggagagttccttaggaaaggaaaaaggacttgaaattttatccctttttgttaat
atgaagaaggcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcaaacagcttcagaataagcagtttaagagaataaggaaatcttcgtcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatccttcagaaggacgttaaggtgcctacaaaggtgtta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattctgtgatcggaatggaaagtcgtttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggatctacataagaagata
atcactcagtttcagagataccaccagccgcatactctttcaccagatcaggaagactgt
atgtattggtacaactttctggcctatcacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcagtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgagccggaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaatgctttacctggaatggataaacaaa
aaaaacatcacgaatctttcccgcttagttgtccgcccccacacagatgctgtttaccat
gcctgcttttctgaggatggtcagagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttttagaaatcaaggctcatgaggatgaagtg
ctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattctatgactggggaactagtacacacctatgatgagcactcagag
caagtcaattgctgccatttcaccaacagtagtcatcatcttctcttagccactgggtca
agtgactgcttcctcaaactttgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcatacaaattcagtcaatcactgcagattttcaccagatgataagcttttggctagt
tgttcagctgatggaaccttaaagctttgggatgcgacatcagcaaatgagaggaaaagc
attaatgtgaaacagttcttcctaaattcggaggaccctcaagaggatatggaagtgata
gtgaagtgttgttcgtggtctgctgatggtgcaaggataatggtggcagcaaaaaataaa
atctttttgtggaatatagactcacgttcaaaggtggctgattgcagaggacatttaagt
tgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatcttctgatgac
cagacaatcaggctctgggagacaaagaaagtatgtaagaactctgctgtaatgttaaag
caagaagtagatgttgtgtttcaagaaaatgaagtgatggtccttgcagttgaccatata
agacgtctgcaactcattaatggaagaacaggtcagattgattatctgactgaagctcaa
gttagctgctgttgcttaagtccacatcttcagtacattgcatttggagatgaaaatgga
gccattgagattttagaacttgtaaacaatagaatcttccagtccaggtttcagcacaag
aaaactgtatggcacatccagttcacagccgatgagaagactcttatttcaagttctgat
gattctgaaattcaggtatggaattggcaattggacaaatgtatctttctacgaggccat
caggaaacagtgaaagactttagactcttgaaaaattcaagactgctttcttggtcattt
gatggaacagtgaaggtatggaatattattactggaaataaagaaaaagactttgtctgt
caccagggtacagtactttcttgtgacatttctcacgatgctaccaagttttcatctacc
tctgctgacaagactgcaaagatctggagttttgatctccttttgccacttcatgaattg
aggggccacaacggctgtgtgcgctgctctgccttctctgtggacagtaccctgctggca
acgggagatgacaatggagaaatcaggatatggaatgtctcaaacggtgagcttcttcat
ttgtgtgctccgctttcagaagaaggagctgctacccatggaggctgggtgactgacctt
tgcttttctccagatggcaaaatgcttatctctgctggaggatatattaagtggtggaac
gttgtcactggggaatcctcacagaccttctacacaaatggaaccaatcttaagaaaata
catgtgtcccctgacttcaaaacatatgtgactgtggataatcttggtattttatatatt
ttacagactttagaataa

DBGET integrated database retrieval system