Pseudomonas putida S16: PPS_2672 Help Entry PPS_2672          CDS       T01570                                  Name (GenBank) MutT/nudix family protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ppt  Pseudomonas putida S16 Brite KEGG Orthology (KO) [BR:ppt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ppt03400]     PPS_2672 Enzymes [BR:ppt01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      PPS_2672 DNA repair and recombination proteins [BR:ppt03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     PPS_2672  Prokaryotic type     PPS_2672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Motif Other DBs NCBI-ProteinID:  AEJ13225 Position complement(2964547..2964861) Genome browser AA seq 104 aa AA seqDB search MRKQGAEWALPGGKIDPGEHHLDTAQRELMEETCLPFNGARFLNHYLLAGEEHYLYQLPV EAGAKPAADHEIVECRWFTAPELHEVRVKPSNIELLEREHLLPV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt gtgcgcaagcaaggcgctgaatgggcgttgccaggcgggaagattgacccaggcgagcat cacctggatacagcgcagcgcgagctgatggaggaaacctgcctacccttcaacggtgct cgattcctcaaccattacctgctcgcaggtgaggagcactacctctatcagctgcctgtt gaagcgggagcaaagcctgctgcagatcacgagatagtcgagtgccgctggttcactgcc ccagagcttcacgaagttcgggtcaagccatccaacatcgagttgcttgaacgagaacac ctgcttcctgtgtaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (1) Pfam (1) All databases (3) Download RDF

DBGET integrated database retrieval system