KEGG   Pseudomonas putida S16: PPS_4079
Entry
PPS_4079          CDS       T01570                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K19700  3-succinoylsemialdehyde-pyridine dehydrogenase [EC:1.2.1.83]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00760  Nicotinate and nicotinamide metabolism
ppt01100  Metabolic pathways
ppt01120  Microbial metabolism in diverse environments
Module
ppt_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PPS_4079
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.83  3-succinoylsemialdehyde-pyridine dehydrogenase
     PPS_4079
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AEJ14618
UniProt: F8G0P0
Position
complement(4609711..4611135)
AA seq 474 aa
MRDYRKFYINGEWIMPVGGEELEVINPATESIAGVITLGTADHVDLAVKSARLAFESWSR
TSKEQRLELLEKVCQIFEARMEDIAGAITEEMGAPFKQLARPLQAPSGLGHFLTAISVLR
NYQFEECSGTTRVVREPVGVCGLITPWNWPMNQVAAKVAPALAAGCTVVLKPSEIAPFSA
YLLAEILDEAGLPPGVFNLINGNGSGVGAPLAAHVDVDLISFTGSTTAGALVSKAAADSV
KRVALELGGKSANIILDDADLASAVSHGVMTMMLNTGQSCNAPSRMLVPASKLLEVERIA
KKLCEEIIVGNPLDERTSLGPLASAVQYERVQVCIRNGLAEGAKLVCGGLGVPDGVRAGY
YAKPTVFSNVANDMAIAQEEIFGPVLCIIPYTDAENAIAIANDSCFGLSGYVSSGSLARA
REVANRLRTGSVHLNGAPLDFSAPFGGYKKSGNGREWGKYGFEEYLEIKSIMGC
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcgtgattatcggaagttttatataaacggcgaatggataatgccagtggggggcgaa
gaactcgaagtgattaaccccgccactgaaagtatagctggtgtaattacactaggaaca
gctgatcatgttgaccttgcggtaaaatcagcgcgccttgcatttgaaagctggtcccgt
acgagcaaagaacaacgacttgagttacttgagaaagtatgtcagatatttgaagccagg
atggaggatatcgctggcgcaattaccgaagagatgggagctccgttcaagcagttagcc
cgccctctccaggcaccatctggcttggggcatttcctaacggcaatctctgtattgcgt
aattaccaatttgaggaatgttcgggaacgactcgtgtagtacgtgagccggtcggagtt
tgcgggttaataacaccttggaactggccaatgaaccaagtggcggcgaaggtcgcacca
gcattagcagctggttgtactgtagtattaaaacccagcgagattgccccattttcagct
tatttacttgcggaaattttggatgaggcgggtcttccgcctggtgtcttcaatcttatt
aatggaaatggttccggtgtgggcgctcctctggctgcacacgtggatgtggatttgatc
tctttcactggttctactactgctggcgcgctcgtctcgaaagcagcagcagattctgtc
aagcgagtagcactagagttgggtggaaaatcggcaaacattatactcgacgacgctgat
ctcgcatctgctgtttcgcatggcgttatgactatgatgctcaataccgggcaaagttgc
aatgctccatcacgcatgctagttccggcatcgaaattgttggaagtagagcggatagca
aagaagctatgtgaagaaataatagtcgggaacccgttagacgaacgcacaagtctcggg
ccgctggcgagcgccgtacagtatgagagagttcaggtctgtatacgaaatggcttagct
gaaggtgcaaagctagtctgtggaggtttaggcgtcccggacggagtaagagctgggtat
tatgctaaaccgacagtttttagcaatgttgcgaacgatatggcgattgcacaggaggaa
atttttggccctgtactttgcattatcccctatacagatgctgaaaatgcgatcgcaata
gcaaatgatagttgttttggtctgtccggatatgttagttcggggagtctggcgcgtgcg
cgcgaggtcgcaaatagactgcgtacaggaagtgtacatcttaacggggcacctctggat
ttttcagcgccgtttggtggttataaaaagtcaggtaacggccgcgaatggggtaaatac
ggctttgaagagtatctcgaaatcaagtcaattatgggctgttaa

DBGET integrated database retrieval system