KEGG   Pseudomonas putida S16: PPS_4081
Entry
PPS_4081          CDS       T01570                                 

Name
(GenBank) amine oxidase
  KO
K20169  nicotine oxidoreductase [EC:1.5.3.-]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00760  Nicotinate and nicotinamide metabolism
ppt01100  Metabolic pathways
ppt01120  Microbial metabolism in diverse environments
Module
ppt_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PPS_4081
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     PPS_4081
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like GIDA Thi4 FAD_binding_3 Lycopene_cycl
Other DBs
NCBI-ProteinID: AEJ14620
UniProt: F8G0P2
Structure
Position
complement(4613081..4614529)
AA seq 482 aa
MSDKTKTNEGFSRRSFIGSAAVVTAGVAGLGAIDAASATQKTNRASTVKGGFDYDVVVVG
GGFAGATAARECGLQGYRTLLLEARSRLGGRTFTSRFAGQEIEFGGAWVHWLQPHVWAEM
QRYGLGVVEDPLTNLDKTLIMYNDGSVESISPDEFGKNIRIAFEKLCHDAWEVFPRPHEP
MFTERARELDKSSVLDRIKTLGLSRLQQAQINSYMALYAGETTDKFGLPGVLKLFACGGW
NYDAFMDTETHYRIQGGTIGLINAMLTDSGAEVRMSVPVTAVEQVNGGVKIKTDDDEIIT
AGVVVMTVPLNTYKHIGFTPALSKGKQRFIKEGQLSKGAKLYVHVKQNLGRVFAFADEQQ
PLNWVQTHDYSDELGTILSITIARKETIDVNDRDAVTREVQKMFPGVEVLGTAAYDWTAD
PFSLGAWAAYGVGQLSRLKDLQAAEGRILFAGAETSNGWHANIDGAVESGLRAGREVKQL
LS
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagtgataaaacaaaaacaaatgaaggctttagccgcaggtcttttatcggaagcgcg
gcagtcgtaacagcaggtgttgcgggattgggagctattgatgcggcttcggctacgcaa
aaaacgaaccgagcaagcaccgtcaaaggtggcttcgattacgatgtggtagtagttggt
ggagggtttgctggcgcgacagccgcccgtgaatgtggtttgcagggttatcgaacgctt
ttattggaagcgaggtcccgcctaggtggtcgtacgtttacctcgcgctttgcaggtcaa
gaaattgaatttggcggggcatgggtgcactggctgcagccgcatgtttgggcagaaatg
cagcgttacggtctgggtgtagtggaagatccacttactaatttagataaaaccttaatc
atgtataacgacggaagcgtcgaaagtatttcgcccgatgaatttggcaaaaacattcga
atagcttttgaaaagctttgtcacgatgcctgggaagtatttcctcgtccgcatgagccg
atgtttactgagcgcgctcgggaattggataaatcttctgttcttgatcgcatcaaaact
ttgggcttaagtcggctgcaacaggctcaaatcaatagttacatggccttgtatgcaggt
gagacaactgacaaatttggcctgcctggtgtacttaagttgtttgcatgcggcggttgg
aactatgacgccttcatggacactgaaactcattatagaattcaagggggcacgataggc
ctcattaatgcaatgttgaccgatagcggtgccgaggtccgcatgtctgtgcccgtcact
gctgttgagcaagtcaatggtggcgtcaaaatcaagaccgacgacgacgaaattattacc
gccggagtggtcgtaatgacagttccactcaatacgtataaacatatcggttttacgcct
gccctttctaaaggtaaacaacgattcatcaaagaggggcagcttagcaaaggtgctaag
ctttatgttcatgttaagcagaatctcggacgggtttttgcgtttgcggatgaacagcaa
cctttaaactgggtccagacgcacgattacagcgacgagttggggacaatactgtcgatc
accatcgctcgcaaagaaacaattgatgtgaatgaccgagatgctgtaactcgcgaagtt
caaaaaatgtttccgggtgttgaggttcttggtacagcggcttacgactggacagctgat
ccattttccttgggggcatgggcggcttatggagtaggtcaactaagtcgtctcaaagat
ctacaggcggctgaaggacgtattttatttgcaggagctgaaaccagtaacggttggcac
gcgaatatcgatggtgctgttgaaagtggactacgtgccggtagggaggttaagcagctc
ttaagctag

DBGET integrated database retrieval system