Pseudomonas putida DLL-E4: DW66_2964 Help Entry DW66_2964         CDS       T03439                                  Name (GenBank) MutT/nudix protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ppud  Pseudomonas putida DLL-E4 Brite KEGG Orthology (KO) [BR:ppud00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ppud03400]     DW66_2964 Enzymes [BR:ppud01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      DW66_2964 DNA repair and recombination proteins [BR:ppud03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     DW66_2964  Prokaryotic type     DW66_2964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Motif Other DBs NCBI-ProteinID:  AHZ77473 Position 3215065..3215310 Genome browser AA seq 81 aa AA seqDB search MLEETGLQAESLTLLMRHEAAERMHYVFEAEFADAPHPKALREIADCRFAHPDQVPMLKD EIKLLIRSLLACDRAMAASVR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ttgcttgaggaaaccgggttgcaggcagaatcgctgaccctgctgatgcgccacgaagcg gcagagcgcatgcattatgtgttcgaagcggagttcgccgacgccccacatcccaaggcc ctgcgtgaaattgctgattgccggttcgcccacccggaccaggtgcccatgctcaaggac gagatcaagctgctgatccgctcgttgctggcgtgtgaccgggcaatggcagcgtcagtg aggtag

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (1) Pfam (1) All databases (3) Download RDF

DBGET integrated database retrieval system