KEGG   Pseudomonas putida H8234: L483_22005
Entry
L483_22005        CDS       T02706                                 
Name
(GenBank) succinate dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00623  Toluene degradation
pput01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    L483_22005
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     L483_22005
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AGN79692
UniProt: R9V4D3
Position
4594828..4596306
AA seq 492 aa
MTLSHSPAYQNLHLQPLAGEWRAGSADQSLEVFDPFTQKRLLQITLANREDLDAAYRRAR
ECQLEWAAKGPAERSQVLLNAVKIFDDRREEIIDWIISESGSTRIKAQIEWGAARAITLE
SASLPSRVHGRIMASNVPGKESRVYRVPLGVIGVISPWNFPLHLTARSLAPALALGNAVV
VKPASDTPVTGGLLLARIFEEAGLPPGVLSVVVGAGAQIGDAFVEHPVPAFISFTGSTQV
GRNIGRIASGGEHLKHVALELGGNSPFVVLADADVEQAVNAAVVGKFLHQGQICMAINRI
IVEQPLLEAFTQRFVERVKALPYGDPSNASTVIGPVINSKQLAGLQQKIVTAHAEGATLL
VGGEAQGNVLPPHVFGNVTADMDIAREEIFGPLVGIQAARDAEHALTLANNSEYGLSSAV
FTSSLERGVQFAQRIHAGMTHVNDIPVNDEPNAPFGGEKNSGLGRFNGDWAIDEFTTDHW
ITLQHVPRAYPF
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgacgctttcccactcccctgcctatcaaaacctgcacttgcagccccttgccggtgaa
tggcgagccggcagcgccgatcaatcgctggaggtgttcgaccccttcacgcagaagcga
ttgctgcaaatcaccctggccaaccgcgaagacctcgatgccgcctaccgcagggcccgc
gaatgccagctcgagtgggcggccaaaggccccgccgagcgcagccaggtcttgctcaat
gccgtgaagatctttgacgaccgccgtgaagaaattatcgactggatcatcagcgagtca
ggcagcacgcggatcaaggcgcaaatcgaatggggcgccgcacgcgccatcaccctcgag
tcggccagcctgccaagccgcgtgcacgggcgcatcatggcgtccaatgtgcccggcaag
gaaagccgcgtctaccgggttcccctgggcgtgattggcgtgatcagcccctggaacttc
cccctgcacctgaccgcacgctccctggcacctgccctggcgttaggcaacgccgtggtg
gtcaagccggccagcgataccccggtcaccggcggcctgctgcttgcgcgaatcttcgag
gaagccggattgccgccgggtgtgctcagcgtggtggtgggggccggcgcgcagatcgga
gacgctttcgtcgagcatccggtgcccgcgttcatttccttcaccggctcgacccaagtc
gggcgcaacatcggccgcatcgccagcggcggcgagcacctcaagcacgtggcgctggag
ctgggcggcaacagcccgttcgtggtcctggctgatgccgacgtcgagcaggccgtcaat
gctgccgtggtgggcaagttcctgcaccaggggcaaatctgcatggcgatcaaccgcatc
atcgtcgagcaaccgttgctggaggccttcacccagcgctttgtcgagcgggtcaaggcc
ctgccttacggcgacccgagcaacgccagcacggtcatcgggccggtgatcaacagcaag
caactggcgggcctgcaacagaagatcgtcactgcccacgccgaaggcgccaccttgctg
gtgggtggcgaggctcaaggcaatgtgctgccgcctcacgtcttcggcaacgttaccgcc
gacatggacatcgcccgtgaagaaatctttggccccctggtcggcattcaggctgcacgt
gatgccgagcatgccctaacgcttgcgaacaacagcgaatacgggctctccagcgccgtc
ttcacctccagcctggagcgcggtgtgcagttcgcccaacgcatccacgccggcatgacc
cacgtcaacgacatcccggtcaatgacgaacccaacgcgccattcggcggcgagaagaac
tcaggtttggggcgtttcaatggcgactgggccatcgacgaattcaccaccgaccactgg
atcaccctgcaacacgtgcccagagcgtacccgttctga

DBGET integrated database retrieval system