KEGG   Prosthecochloris sp. CIB 2401: Ptc2401_00216
Entry
Ptc2401_00216     CDS       T04424                                 

Definition
(GenBank) radical SAM protein, family
  KO
K21312  bacteriochlorophyllide c C-7(1)-hydroxylase [EC:1.17.98.2]
Organism
proc  Prosthecochloris sp. CIB 2401
Pathway
proc00860  Porphyrin and chlorophyll metabolism
proc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:proc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ptc2401_00216
Enzymes [BR:proc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.98  With other, known, physiological acceptors
    1.17.98.2  bacteriochlorophyllide c C-71-hydroxylase
     Ptc2401_00216
SSDB
Motif
Pfam: Radical_SAM
Other DBs
NCBI-ProteinID: ANT64024
UniProt: A0A1B1PZJ3
Position
216573..217781
AA seq 402 aa
MSTKRVITKEDIHLKARLLSEGAKVTVNKPPANGYNPFRAMVLNGSDLATLVRQEPYTRL
EVQVNGDDVEFLDCGKHLAYGRMQEWFSWRDGNLSNGRPVNAAVIGMNQDIINIHYSYSC
DNNNTGRSCKFCFFFADQHVGVGQELAKMPVKKIEALAQEQAEAVKIATDAGWRGTLVVI
GGLVAPERRSQVADLVDIVMDPLREQLSPEVFNELHITANLYPPDDFKEMERWKAAGINS
TEFDLEVMHPDYFKAICPGKCATYPLDYWLAAQEASVEIFGPGRGTTSFILMGLEPMNLM
LEGVEERMSKGVYPNMLVYQPVPGADMFRMPGPNADWLVEASEKIADLYFKYEDKFDMPL
AKDHRPGYTRMGRSQYILLAGDEVARRLYEQGHELPEAYPVC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgagtacaaaacgagtgattacgaaagaagacatccacctgaaggcccgtcttctttcc
gagggtgctaaagtgactgtcaacaagccacctgctaacggatacaatccgttcagggca
atggttcttaatggcagtgaccttgccacgcttgtgcgccaggagccttatacccgtctt
gaagtccaggtgaacggggacgatgtggaattccttgattgcggcaagcatcttgcatac
ggaagaatgcaggagtggttttcctggagggatggaaacctgagcaatggccgcccggtc
aatgctgcggttatcgggatgaaccaggatatcatcaatatacattacagctacagctgc
gataacaacaataccggccggtcatgcaagttctgcttcttttttgcagaccagcatgtc
ggcgtagggcaggaacttgccaaaatgccggtcaagaagatcgaagcccttgcacaagaa
caggctgaagcggtcaagatagcgaccgatgcaggatggcgaggaacccttgtggttatc
ggcggccttgttgctccagagaggcgctcccaggttgctgatctggtggatatcgtcatg
gatccgcttcgtgagcagctgagcccggaagtgttcaatgagctccatatcacggcaaac
ctctatccgccagatgatttcaaggagatggagcgctggaaagccgcaggtatcaattct
actgaatttgatcttgaagttatgcacccggattacttcaaggcaatatgcccgggaaaa
tgcgcaacatacccgttggattactggcttgctgcccaggaagcatcggtagagattttc
gggccgggtcggggaacgaccagctttatccttatgggtcttgagcctatgaatcttatg
cttgagggtgtcgaagagcgaatgtcgaaaggcgtttatcccaacatgctggtgtaccag
cctgtcccgggcgcggatatgttccgcatgccaggacccaatgctgactggttggtagaa
gcgtcggaaaagattgctgatctttactttaagtatgaagacaagttcgatatgccgctt
gccaaggatcatcgtcccggctacaccaggatggggcgttcccagtacattctgcttgct
ggtgacgaggtagcaaggcggttgtatgagcaggggcatgagttgcctgaagcttaccct
gtctgctga

DBGET integrated database retrieval system