KEGG   Paenibacillus rhizovicinus: GZH47_23250
Entry
GZH47_23250       CDS       T06983                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
prz  Paenibacillus rhizovicinus
Pathway
prz00541  O-Antigen nucleotide sugar biosynthesis
prz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    GZH47_23250
Enzymes [BR:prz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GZH47_23250
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD adh_short Polysacc_synt_2 adh_short_C2 KR
Other DBs
NCBI-ProteinID: QHW33422
UniProt: A0A6C0PA67
Position
5175165..5176187
AA seq 340 aa
MSRPRLLVTGAGGFCGEHACRHFASLGWQVIAAVRRLPAAAAAEWAWLGGVDAVLACDLS
SRSETEALAERAAPDYVLHLAGANAVGASWSDPASVLQSNVMGTVHLLEGIRRLGKPCRV
LVAGSMLRFPLAGSGEAGKSPAAGGAEASAAGTAGAGAARPADGPRPQHPYSLSKTMQVL
VAQSWSSLFGMEVIVAEPSNLIGPGRSGGLCGLLARYAAVSERAAAAGDAAPAPFRFSSR
SEQRDLLDVRDAIAAYEMLFQAGESGRVYPVASGIMRTLGEIAGAFGEVALQPLRWEFGD
SDAASPAPADIGAIAALGWSPSYSLKRSLDDALAAARLSV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagccggccgcgcctgcttgttacgggcgccggagggttctgcggcgagcacgcttgc
cggcatttcgcttcgctcggctggcaggtgattgcagcggttcgccggcttcccgctgcg
gccgcggcggaatgggcatggctcggcggcgtcgatgccgtcctggcctgcgatctgtcc
tcgcgaagcgagacggaagcgctggcggaacgagcggcgccggattacgtgctccatctg
gcgggcgccaacgccgtcggcgcgtcgtggagcgaccccgcatcggtgctgcaaagcaat
gtgatgggtacggttcatttgctggaagggatccggcggctgggtaaaccgtgcagggtg
ctggtcgcgggatctatgctgcgcttcccgcttgccgggtccggggaggccgggaagtcg
ccggcagccggcggcgccgaggcgtccgctgccggaacggccggcgcaggcgcggcgcgg
cctgcggacggtccccggccgcagcatccgtacagcttgagcaagacgatgcaggtgctc
gtcgcgcagagctggtcgtcgctgttcggcatggaagtcatcgtcgcggagccgtcgaat
ctgatcggccccggccgatcgggcggattgtgcggcttgctcgcgcgctacgcggcggtc
tcggaacgcgcggcagcagcaggcgacgctgctcctgcgccgttccggttctcctcgcgg
agcgagcagcgggatctgcttgacgttcgcgatgcgattgccgcgtacgagatgctgttc
caggccggcgagagcggccgcgtctatcccgtggcgtccggcatcatgcgtacgctgggg
gagatcgccggcgcgttcggcgaggtcgcgctgcagccgctgcgctgggagttcggcgat
tccgacgccgcttcgccggcgcccgcggatatcggcgcgatcgccgcgcttggctggtcg
ccgagctattcgctgaagcggtcgctggacgatgcgcttgcagccgcaaggctgtccgtt
taa

DBGET integrated database retrieval system