KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2611
Entry
Psyr_2611         CDS       T00246                                 

Name
(GenBank) Amino acid adenylation
  KO
K16126  L-threonine---[L-threonyl-carrier protein] ligase [EC:6.2.1.70]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    Psyr_2611
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:psb01008]
    Psyr_2611
Enzymes [BR:psb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.70  L-threonine---[L-threonyl-carrier protein] ligase
     Psyr_2611
Polyketide biosynthesis proteins [BR:psb01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Syringomycin synthetase
    Psyr_2611
SSDB
Motif
Pfam: AMP-binding AMP-binding_C PP-binding
Other DBs
NCBI-ProteinID: AAY37650
UniProt: Q4ZT72
Position
complement(3093701..3095545)
AA seq 614 aa
MPITNTDESLSAASAPLKPGAFLHEIFSDRARQFPERTAVSDAARTLSYAQLDALSTKLA
ARLRDEGVTYGTRVGMYLPRSVDLVTSLLGILKAGGTYVPVDPQYPGKRVEHIVRDSELS
LIIGDAANLPKISSLRVLALDELLSAPALQPAAQDTRIDPNNSTAYIIYTSGSTGEPKGV
QVSHGNVSRLLESTQRAYGFNAQDVWSMFHSIGFDFSVWEIWGALAHGGQVAVVPYDISR
SPAALRQWLADQRITVLSQTPSAFRGLDEADRGNTAPLALRYVVLGGEALPASVLRPWVE
RHGDQKPALINMYGITEATVHTTFKRVLAQDLETAAMVSLGKPLHGWRLHLLDANQAPVA
AGTTGELYIEGAGVAQGYLNREALNVERFVELPGAVRAYRTGDLMTLESNGEYRYAGRCD
EQLKISGFRIEPGEIEASLQTSPSVAAAHVGVHDYGDGDLRLVAYVVPGQGVDAWTEQAR
SEVAALMAENLPEYMRPSVYVPLAELPVTHHGKIDKQQLPSPAAGTALSGAADVKGLSEQ
EHFVLKVWSEDLGLKNIGVNDDFFDSGGTSLALIRSLSKLKTHYKINLDPGILADGATAK
VLADHITRSLVQAH
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgccgattacgaacactgacgaatcgcttagcgccgcgtcagcccctctcaagcccggt
gctttcctgcacgagatattcagtgacagggcgcgtcaatttcctgagcgcaccgcggtg
agcgatgcagcccggacgttgagctacgcacagctcgacgcgctgtcgacaaagctggct
gcacgtttacgcgatgaaggcgtgacctacggcacgcgtgtgggcatgtacctgccgcgc
agcgtcgatctggtcaccagcctgctgggtattctcaaagccggcggcacctatgtgccg
gtcgacccgcaataccctggcaaacgcgtcgagcacatcgtgcgcgacagcgagctgagc
ctgatcatcggcgatgccgccaacctgccgaaaatatcgtctctgcgcgtattggcactc
gacgagttactgtccgcgccggcgctgcaaccggccgctcaagacacccgtatcgacccg
aataattccactgcctacatcatctacacctctggctccaccggtgagcccaagggcgta
caggtttcccatggcaacgtcagtcgcctgctggaaagtacccaacgcgcctatggcttc
aacgcccaggatgtctggtcgatgttccactccatcggtttcgacttctcggtctgggaa
atctggggtgccctcgcccacggcggccaggtggccgttgtcccgtatgacatctcgcgc
tctcctgccgccctgcgtcaatggctcgccgatcagcgcatcaccgtgctcagccagacg
ccatcggctttccgtggtcttgatgaggccgatcgtggcaacaccgcgccgctggcgctg
cgctacgtggtgctcggtggcgaagcgttgcccgccagcgtgctgcgtccctgggtcgag
cgccacggtgaccagaagcccgcgctgatcaacatgtacggcatcactgaggccaccgtt
cacaccaccttcaagcgagtgttggcgcaggacctggaaacagcagccatggtgtcgctg
ggcaagccgctgcacggctggcgcctgcacctgcttgacgccaaccaggcgccggtcgcg
gcaggcactaccggcgagctgtacatcgaaggcgcgggcgtggctcagggctacctgaac
cgtgaggcgctcaacgtcgagcgcttcgtcgagttacccggtgctgtgcgcgcctatcgt
actggcgacctgatgaccctggagagtaatggcgaataccgttatgccggtcgctgcgac
gagcaattgaaaatcagcggtttccgcatcgagcccggcgagatcgaagcctctctgcaa
accagcccgagcgtggccgcggcccatgtcggcgtacatgattacggcgatggtgacctg
cgcctggtagcttacgtggtgccaggccagggcgtcgacgcctggaccgaacaggctcgc
agcgaagttgccgcattgatggccgaaaatttgccggagtacatgcgtccctcggtgtat
gtgccgctggcagagctgccggtgactcatcacggcaaaatcgacaagcaacaactgccc
tcgcctgccgctggcacggcgctttcaggcgcggcagacgtcaagggcctcagtgaacag
gagcacttcgtgctcaaggtctggagcgaagacctgggtctgaaaaacatcggcgtcaat
gatgatttcttcgattccggcggcacttcactggcactgatccgctcgctgagcaagctc
aagacacattacaaaatcaacctcgaccccgggatcctggcggatggcgcaacggccaaa
gtcctggccgaccacatcacccgtagccttgttcaagcccattga

DBGET integrated database retrieval system