KEGG   Pseudomonas sp. TCU-HL1: THL1_4171
Entry
THL1_4171         CDS       T05373                                 

Name
(GenBank) cytochrome P-450cam, subunit of camphor 5-monooxygenase system
  KO
K21569  camphor 5-monooxygenase [EC:1.14.15.1]
Organism
pset  Pseudomonas sp. TCU-HL1
Brite
KEGG Orthology (KO) [BR:pset00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pset00199]
    THL1_4171
Enzymes [BR:pset01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.1  camphor 5-monooxygenase
     THL1_4171
Cytochrome P450 [BR:pset00199]
 Cytochrome P450, bacteria type
  CYP101 family
   THL1_4171
SSDB
Motif
Pfam: p450 DUF6158
Other DBs
NCBI-ProteinID: AOE86719
UniProt: A0A1B3EAY9
Position
4470433..4471680
AA seq 415 aa
MSTEAIQSNANLAPLPPHVPEHLVFDFDMYNPPNISEGVQKAWATLQGPNVPNIVWTRCN
GGHWIATRGRLIREAFEDPAHFSSECPFIPREAGEAYDFIPTSMDPPEQRQFRALASSVV
GMPVVDKMEGHIRELACSLIDNIRLQGHCNFTEDFAEPFPIRIFMLLAGLPDKDIPHLKY
LSDQMTRPDGSMTFAEARDALYEYLMPIIAERKLKPCTDAISVIANGQVNGRPITSDEAK
KMCGLLLVGGLDTVVNFLSFCMEFLAKSPEHRKELIEHPERIPAATEELLRRFSLVADGR
ILKSDLEFHGVLLKKGDQILLPQLLSGLDERENACPMHVDFGRQKVSHTTFGHGSHLCLG
QHLARREIVTTLREWLARIPDFAIAPGAQVRHQSGIVSGVHALPLVWDPATTKAV
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagtactgaagccatacagagcaatgccaatcttgcgcccctgccgccccatgtacct
gagcacctggtttttgacttcgacatgtacaacccaccgaacatatcggaaggcgtgcag
aaagcctgggcgactctgcagggaccgaatgtaccgaatattgtatggactcgatgcaat
ggcgggcactggattgccacccggggacgattgatccgtgaggccttcgaagatcccgca
cacttttcgagcgagtgtccgttcattccccgcgaagcgggcgaggcctacgacttcatt
cccacttcgatggatccgccggagcagcgccagttccgcgccctagccagcagcgtggtg
ggtatgccggtagtggataaaatggaaggtcatatcagggagctggcgtgctcactgatc
gacaacatccgccttcagggtcactgcaactttaccgaagattttgccgagcccttcccg
attcggatcttcatgctgctcgcggggctgccggataaagacattccgcatctgaaatac
ctctcggatcagatgactcgcccggatggcagcatgacctttgctgaagccagagacgcg
ctctatgagtatctgatgccaatcatcgcagagcgcaaactgaagccttgtactgacgcc
ataagcgtaatcgccaatggccaggtcaacgggcgcccaatcaccagcgacgaagccaag
aaaatgtgtggtctgctgctggttggtggcttggataccgtagtcaatttcctcagcttc
tgcatggagtttctggccaaaagcccagagcaccgcaaagagttgatcgagcatccagag
cgcattccggctgccaccgaggaactgctccgacgcttttcgctagtagctgatggccga
attctcaagtccgaccttgaattccatggcgtgctactaaagaagggcgatcagatcctc
ctgccgcaactgctgtcgggcctggatgagcgtgagaacgcctgcccgatgcacgtcgac
ttcggccgccagaaggtatcgcatacgacatttggtcacggcagtcatctgtgccttggc
cagcatctagcccgccgcgaaatcgtcaccaccctacgggaatggctagccaggattcct
gactttgccattgccccgggcgcgcaggtgcgccaccagagtggcattgtcagcggcgtg
catgcactcccgctggtctgggatccggccactaccaaagcggtataa

DBGET integrated database retrieval system