KEGG   Pseudomonas sp. TCU-HL1: THL1_648
Entry
THL1_648          CDS       T05373                                 
Name
(GenBank) 4-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00623  Toluene degradation
pset01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    THL1_648
Enzymes [BR:pset01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     THL1_648
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AOE83196
UniProt: A0A1B3E0X3
Position
complement(715425..716900)
AA seq 491 aa
MDTIRPAYQNLELQPLAGQWRAGSTGRQLEVFDPYNDQALLSITLASREDLDAAYRMARD
SQREWAAKAPAERARVLLDAVKIFDERREEIIDWIIRESGSTRIKAQIEWGAARAITLES
ASLPNRVHGRIVASNIPGKESRVYRAPLGVIGVISPWNFPLHLTARSLAPALALGNAVVV
KPASDTPVTGGLLLARIFEEAGLPAGVLSVVVGSGAEIGDAFVEHSVPAFISFTGSTQVG
RNIGRIASGGEHLKHVALELGGNSPFVVLADADLEQAVHAAVVGKFLHQGQICMAVNRII
VEAPLVEAFTQRFVERVKALPYGDPSKPETVVGPVINARQLAGLKEKVATAKAEGATLLV
GGEPQGNVMPPHVFGNVTADMEIAREEIFGPLVGIQSARDAEHALELANRSEYGLSSAVF
CGSLERGVQFAQRIHAGMTHVNDIPVNDEPNAPFGGEKNSGLGRFNGDWAIEEFTTDHWI
TLQHSPRPYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggacaccatccgccctgcctaccaaaacctcgagttacagcccctcgccgggcaatgg
cgcgccggcagtaccggtcgccagctggaggtcttcgacccctacaacgaccaggccctg
ctgagcattaccctggccagccgcgaggacctcgacgcggcctaccgcatggcccgcgac
agccagcgggagtgggcggcgaaggcaccggccgagcgcgcccgggtactgctggacgcg
gtgaagatcttcgatgagcgccgcgaggagatcatcgactggatcattcgcgagtccggc
agcacccgcatcaaggcgcagatcgaatggggcgccgcccgtgccatcaccctggagtcg
gccagcctgccaaaccgcgtgcacggccgcatcgtcgcctccaacatccccggcaaggaa
agccgcgtgtaccgcgcgccgctcggggtgatcggcgtcatcagcccgtggaacttcccc
ctgcacctcaccgcccgctccctggccccggccctggccctgggcaacgccgtggtggtc
aagccggccagcgacaccccggtcaccggcggcctgctgctggcgcgcatcttcgaggag
gccggcctgccggcgggcgtgctgagcgtggtggtgggctcgggcgcggaaatcggcgac
gccttcgtcgaacactcggtgccggccttcatctccttcaccggttccacccaggtgggc
cgcaacatcggccgcatcgccagcggcggcgagcacctcaagcacgtggcgctggagttg
ggcggcaacagccccttcgtggtcctggccgacgccgacctggaacaggcggtgcacgcc
gccgtggtgggcaagttcctccaccagggccagatctgcatggcggtcaaccgcatcatc
gtcgaggcccccctggtggaggccttcacccagcgcttcgtcgagcgggtcaaggccctg
ccctacggagacccgagcaagcccgagaccgtggtcggcccggtgatcaacgccaggcaa
ctggccggcctgaaggagaaggtcgccaccgccaaggcagaaggcgccaccctgctggtg
ggcggcgagccccagggcaacgtcatgccgccccacgtgttcggtaacgtcaccgccgac
atggaaatcgcccgcgaggaaatcttcggcccgctggtgggcatccagtccgcccgcgac
gccgagcacgccctggagctggccaaccgcagcgagtacggcctgtccagcgcggtgttc
tgcggcagcctggagcgcggcgtgcagttcgcccagcgcatccacgccggcatgacccat
gtgaacgacatcccggtcaacgacgaacccaacgcccccttcggtggcgagaagaactcc
ggcctcggccgcttcaacggcgactgggccatcgaggagttcaccaccgaccactggatc
acactgcaacacagcccgcggccctatccgttctga

DBGET integrated database retrieval system