KEGG   Pseudocitrobacter sp. G163CM: G163CM_05810
Entry
G163CM_05810      CDS       T07750                                 
Symbol
wfgD
Name
(GenBank) UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Organism
psgc  Pseudocitrobacter sp. G163CM
Brite
KEGG Orthology (KO) [BR:psgc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psgc01005]
    G163CM_05810 (wfgD)
Enzymes [BR:psgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.305  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase
     G163CM_05810 (wfgD)
Lipopolysaccharide biosynthesis proteins [BR:psgc01005]
 O-antigen repeat unit
  G163CM_05810 (wfgD)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Other DBs
NCBI-ProteinID: UGS39896
Position
666600..667382
AA seq 260 aa
MQNLNNSLVSIIMPIYNGEAYIHDSISSVKKQSYDNWELIIIDDHSNDASLQIAQKYAEQ
DERVKVFQTEMLCSGAAKARNLGVQYCTGRYIAFLDCDDYWSANKIQLQIALMKEHNANF
CYGSYAIFSGHVNNLIGEFRPQSLISYSKLLRGCDIGCLTVMYDSYALGKHFFPMVDKED
YALWLKILKSEHARVVLCESIIAFYRVSSESLSSNKWRELVRQYNVYRRVEGIGVLKSLF
YLSCYACYGLKKHYINYRGK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcaaaatttaaataattcattagtttcaattattatgcctatatataatggtgaggcc
tatattcatgattctatatcatcagttaaaaaacaaagttatgataattgggagttaata
attattgatgatcattcaaatgacgcaagtttacaaatagcgcaaaaatatgcagagcaa
gatgaaagggtcaaagtatttcaaacagagatgctttgtagtggagctgcaaaagcaaga
aatttgggagttcaatattgtactggtcgatatatagcatttctagattgtgatgactat
tggtctgctaataaaattcagttgcaaatagcattgatgaaagaacataatgctaatttt
tgttatgggtcttatgctatattttctggtcatgtaaacaacctcattggcgaatttcgg
ccacaatcactaataagttacagcaaattgcttaggggatgtgatattggttgcttgacc
gtaatgtatgattcatatgccttggggaaacatttttttcctatggttgataaagaagat
tatgctctttggttaaaaatacttaagtctgagcatgccagagtagtgctctgtgaaagt
attattgctttttatcgagtgtcttcagaatcactctcgtctaataaatggagggagtta
gtacggcaatataatgtttatcgcagggttgaaggtattggagtgctcaagtctctattt
tatttatcctgttatgcgtgctatggattgaaaaaacattacataaattatagaggtaaa
taa

DBGET integrated database retrieval system