KEGG   Pseudomonas silesiensis: PMA3_18555
Entry
PMA3_18555        CDS       T05412                                 
Name
(GenBank) aldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00623  Toluene degradation
psil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    PMA3_18555
Enzymes [BR:psil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     PMA3_18555
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ANJ57040
UniProt: A0A191YVX5
Position
4190431..4191906
AA seq 491 aa
MIVTRPAYQNLELQPLAGNWRAGSAGRPLEVFDPFTQTRLLQITLANRDDLDEAYRKARE
TQVNWAAQGPAARGQVLLNAVKIFDERREEIIDWIIRESGSTRIKAQIEWGAARAITLES
ASLPSRVHGRILASNIPGKESRVYRTPLGVIGVISPWNFPLHLTARSLAPALALGNAVVV
KPASDTPVTGGLLLARIFEEAGLPAGVFSVVVGAGAEIGDAFVEHPVPSFISFTGSTQVG
RSIGRIASGGEHLKHVALELGGNSPFVVLADADVEQAVSAAVVGKFLHQGQICMAINRII
VEQPLLETFTRRFVERVKALPYGDPAKAETVIGPVINSKQLAGLQAKIATARAEGATLLV
GGEAEGNVLPPHVFGDVTADMDIAREEIFGPLVGIQSARDAEHALELANRSEYGLSSAVF
TSSLERGVQFAQRIHAGMTHVNDIPVNDEPNAPFGGEKNSGLGRFNGDWAIEEFTTDHWI
TLQHAPRPYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgatcgttactcgccctgcctatcaaaaccttgaactgcagcccctcgccggtaactgg
cgtgccggcagcgccggtcgtccgctggaggtgttcgaccccttcacccagacacgcctg
ctgcagatcaccctggccaaccgcgatgatctcgatgaggcttaccgcaaggcacgggaa
acccaggtcaattgggcagcccaagggccggccgcccgtggccaggtcctgctcaacgcg
gtgaagatcttcgacgagcgccgtgaagaaatcatcgactggatcatccgtgagtccggc
agcacccgcatcaaggcgcaaatcgaatggggcgccgcccgcgccatcacactcgagtcg
gcgagcctgccaagccgggtgcacgggcgcattcttgcctccaacatcccgggcaaggaa
agccgcgtctaccgtacgccactgggcgtgatcggcgtgatcagcccgtggaatttcccc
ctgcacctgaccgcccgctccctggcccccgccctggcgctgggcaacgcggtggtggtc
aagcccgccagtgacacccctgtcaccggcggcctgttgctcgcacgcatcttcgaggaa
gccggattgccggcgggcgtgttcagtgtggtggtcggtgccggcgcggaaatcggcgac
gccttcgtcgaacacccggtcccgtcgttcatttccttcaccggctcgacccaggtggga
cgctccatcggccgcatcgccagtggcggtgagcacctcaagcacgtggccctggaactg
ggcggcaacagtccgttcgtggtgctggccgatgccgacgtcgagcaggccgtcagtgcc
gccgtggtgggcaagttcctccaccagggccagatctgcatggcaatcaaccgcatcatc
gtcgagcagccgctgctggaaaccttcacccggcgtttcgtcgagcgggtcaaagccctg
ccctacggtgatccggccaaagcggaaaccgtgatcggcccggtgatcaacagcaagcaa
ctggcggggctgcaagcgaagatcgccaccgcccgagccgaaggcgccacgctgctggtg
ggcggtgaagccgagggcaacgtcctgccgccgcatgtgtttggcgacgtcaccgccgac
atggacattgcccgagaagagatcttcgggccactggtgggcattcaatccgcccgcgat
gccgagcacgccctggaactggccaaccgtagcgaatatggactgtccagcgccgtattc
acctccagcctggagcgcggcgtgcagttcgcccaacgcatccacgccggcatgacccac
gtcaacgacatcccggtcaacgacgaacccaatgcgccgttcggcggtgagaagaactcc
ggcctcggacgcttcaacggcgactgggcgatcgaggagttcaccaccgaccattggatc
accctgcaacacgcccccagaccgtacccgttctga

DBGET integrated database retrieval system