KEGG   Papaver somniferum (opium poppy): 113274966
Entry
113274966         CDS       T05758                                 

Name
(RefSeq) berberine bridge enzyme-like 8
  KO
K22089  tetrahydroprotoberberine oxidase [EC:1.3.3.8]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00945  Sanguinarine biosynthesis, (S)-reticuline => sanguinarine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113274966
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.8  tetrahydroberberine oxidase
     113274966
SSDB
Motif
Pfam: FAD_binding_4 BBE DUF5390
Other DBs
NCBI-GeneID: 113274966
NCBI-ProteinID: XP_026380178
Position
4
AA seq 537 aa
MMMSSSNILPLVTFLVLVFFSSGSWAANNSLNGDFLQCIKKNEYSSIPIPIFTPDNSSFT
TIFRSSARNLRFLTPNSTQTPQFIITPTHESHVQSAVVCSQKHGFDLKVRSGGHDVEGLS
YVSDTPYVLVDLINFRNIIVDLKEKTAWIQAGASLGEVYYQAANKSNNTLGFPAGFCPTV
GVAGHISGGGFGALVRKYGLASDQVIDARIVTVDGKIYTKETMGKDLYWAIRGGGANNFG
VLLSWKVKLVPVTPVVTVATISRTLEQGATDLVHKWQFVADRLHEDVYIGLTFSVANSSR
AGGKTVSVQFAFLFLGGSDRLLELMEESFPELGLKRNETTEMKWVESHVYFYARGRPIEL
LWDRDHATKSFLKIKADYVREPISKSGLEAIWRRFVGGDSPAMLWTPFGGRMNEISEFET
PYPHRAGNIYNIMYVGNWMNETESEKQIDWMRRFYNSMARYVSKNPRSAYINYKDLDLGV
NRNNVSEAVGYVQARSWGRKYFKSNFERLVKVKSMVDPGNFFKNKQSIPPVSTWGKQ
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgatgatgagttcatctaatattctccccttagttacattccttgtattagtattcttc
tcaagtggttcttgggcagctaataattcacttaatggagattttctccaatgcattaag
aagaatgagtactcctcaattccaatcccaatttttacacctgataattcttcatttaca
actatctttcggtcttcggctcggaaccttagatttctaacacccaactcaacacaaaca
cctcagtttataatcacaccaacccatgaatctcatgttcaatcagctgttgtttgttct
caaaaacatgggtttgatcttaaagtacgaagtggtggtcatgacgtcgaaggtttatct
tacgtatctgacacgccatacgtcttggtcgacttaattaattttcgaaacattattgtt
gatttgaaagaaaagactgcatggattcaagctggtgcttcacttggagaggtttattat
caagctgcaaacaagagcaacaacacccttggatttccggcaggattttgtcctactgta
ggtgttgctggacacattagtggaggtgggtttggtgccttggtacgaaaatatggcctt
gcgtcagaccaggtcattgatgctcgcattgtcactgttgacggcaaaatttacaccaaa
gaaaccatggggaaagatctgtattgggctattagaggaggtggtgctaataactttgga
gtgcttctttcctggaaggtcaagttggttcctgtcacacccgtcgtgactgttgctacg
atcagcagaacattagaacaaggtgccacggacctagttcataagtggcaatttgttgcc
gatagactccacgaggacgtatacattgggctcacattttcggtcgctaactctagccga
gcaggaggaaaaacggtatcagttcaattcgcgttcttgttcttaggaggcagtgacaga
cttcttgaactcatggaggagagcttccctgaattgggtttgaagcgaaatgaaactact
gaaatgaaatgggttgaatctcatgtatacttctacgcacgaggtagaccaatcgagcta
ttatgggatagagatcatgcaacaaagagtttcctaaaaataaaagctgattacgtgagg
gaaccaatatcaaaatccggtttagaagctatttggagaaggtttgtaggaggagattca
ccagcaatgttatggactccttttggtggtagaatgaacgagatttcggaatttgaaact
ccttacccacatagagctggcaatatttacaacattatgtacgtcggaaattggatgaat
gagactgaatcagagaagcagattgattggatgagaaggttttataactccatggctcgt
tatgtttccaagaatccaagatcagcatatatcaactacaaagatctcgacttaggagtt
aaccgtaacaacgttagcgaggcggtggggtacgtacaagcaagatcatggggtagaaaa
tacttcaaaagtaactttgaaagattagtcaaagttaagagcatggttgatcctggtaat
ttcttcaagaacaaacaaagtattcctcctgttagtacttggggcaagcagtag

DBGET integrated database retrieval system