KEGG   Papaver somniferum (opium poppy): 113275170
Entry
113275170         CDS       T05758                                 

Name
(RefSeq) vestitone reductase-like
  KO
K22098  noscapine synthase [EC:1.1.1.415]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00946  Noscapine biosynthesis, (S)-reticuline => noscapine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113275170
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.415  noscapine synthase
     113275170
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA adh_short KR FANCI_HD2
Other DBs
NCBI-GeneID: 113275170
NCBI-ProteinID: XP_026380398
Position
4:complement(38136690..38138430)
AA seq 252 aa
MEGEHRNDQEGNGKIVCVTGGAGYLASWLIMRLLQRGCSVRTTIRSDPKFKEDVSHLKAL
PEAAEKLQIFEADLETPESFDAAIDGCIGVFLVAQGIGLEQAYTQEKLLKTSVEGILGIL
KSCLKSKTVKKVVYTSSSAASMMVSNLKVVKEIDETMWSEVDHFIGKPENVIPAGLAYVV
SKTLTERAAMKFSEEHGLDLVTILPSMIVGPFIIPNLPESVSLALSVILGDRTKMIRLKP
TNAVHIDDVASA
NT seq 759 nt   +upstreamnt  +downstreamnt
atggaaggagagcacagaaatgatcaggaaggaaatgggaagatagtatgtgtaacaggt
ggtgctggatacttggcatcttggctcatcatgagattgcttcaacgtggatgctccgtt
cggaccaccattcggtctgaccccaaatttaaggaagatgtaagccacctgaaagccctt
cctgaggctgcagagaagctccaaatttttgaagcagatcttgaaacccccgaaagtttt
gacgctgcaattgacgggtgtatcggtgtctttctcgttgctcaaggaattggtcttgaa
caagcctacactcaagaaaaattactcaagacatctgtggaaggaattcttggaattctc
aagtcatgcttgaagtctaaaacagtgaaaaaagttgtgtacacatcttcttcagctgca
tcaatgatggtaagtaatctcaaagttgtaaaagaaattgacgagacaatgtggtccgaa
gttgaccatttcattggcaaacccgaaaatgtcattcctgctggtctagcatatgtggtt
tcaaagactctgacagaaagagctgccatgaaattttctgaagaacatggattggatctt
gttactatacttccttctatgattgttggtccatttatcattcccaaccttcctgagagt
gtttctctggccctttctgtaattttgggtgacaggacgaagatgatccgtcttaaacct
acaaatgcagtacatatagatgatgttgcttcagcatag

DBGET integrated database retrieval system