KEGG   Papaver somniferum (opium poppy): 113303821
Entry
113303821         CDS       T05758                                 

Name
(RefSeq) reticuline oxidase-like
  KO
K00307  reticuline oxidase [EC:1.21.3.3]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00950  Isoquinoline alkaloid biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Module
psom_M00945  Sanguinarine biosynthesis, (S)-reticuline => sanguinarine
psom_M00946  Noscapine biosynthesis, (S)-reticuline => noscapine
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    113303821
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.3  reticuline oxidase
     113303821
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 113303821
NCBI-ProteinID: XP_026408692
Position
8
AA seq 535 aa
MMCRSLTLRFFLFFVLLQTCVRGGDVNDNLLSSCLNSHGVHNFTTLSTDTNSDYFKLLHA
SIQNPLFAKPTVSKPSFIVMPGSKEELSRTVHCCTRESWTIRLRSGGHSYEGLSYTADTP
FVIVDMMNLNRISIDVESETAWVESGATLGELYYAIAQSTETLGFTAGWCPTVGSGGHIS
GGGFGMMSRKYGLAADNVVDAILIDSTGSILDREKMGEDVFWAIRGGGGGVWGAVYAWKI
KLLPVPEKLTVFRVTKNVGIEGASSLLHKWQYVADELDEDFTVSVLGGVNGNDAWLMFLG
LYLGREDAAKTIIDEKFPELGSVEEEFQEMSWVASTAFLSGLETVSELNNRFLKFDERAF
KTKVDFTKEPVPLNVFRRALEMLSEQPGGFIALNGFGGKMSEISTDFTPFPHRKGTKLMF
EYIIAWNQDEETKIEEFSEWLTKFYDYLEPFVSKGPRVGYVNHIDLEIGGIDWRNKSSTS
NAVEIARNWGERYFSSNYERLVKAKTLIDPNNVFNHPQSIPPMMKFEENYMLKEL
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgatgtgcagaagcttaacattacgtttcttcttattctttgttttattacaaacatgc
gtacgaggtggtgatgttaatgataatctcctctcgtcatgtttaaactcccatggtgtt
cacaatttcaccacgctatcaactgatacaaattccgactacttcaaactgctgcatgca
tctatacaaaacccgttgttcgcgaagcctacggtatcgaaaccgtcgtttattgtaatg
cccggcagcaaagaagaattatcgaggaccgttcattgttgtacaagagaatcatggact
attcgactgcggagcggcggtcatagttatgaagggctgtcttacactgctgatacgcct
tttgtgattgttgatatgatgaacttgaatcgaatttccattgatgtcgagtcggaaaca
gcttgggttgaatccggtgcaacgcttggagaactctactatgcgattgcgcagtcaacg
gaaacactggggtttactgctggttggtgtccgactgttggtagcggaggccatataagt
ggtggtggttttggtatgatgtcgagaaagtacgggttagctgcggataacgtcgtggac
gcgattcttatagatagcacagggtcaattcttgaccgtgaaaaaatgggagaagatgtt
ttttgggctattcgtggtggcggcggaggtgtctggggtgcagtttacgcgtggaaaatc
aaactattgcctgtcccggagaagctgaccgttttccgtgtgacaaaaaatgtaggaatt
gaaggcgcttcatctttacttcacaaatggcaatatgttgcagatgaattagacgaggat
tttacggtatctgtgctcgggggagtaaacggaaatgatgcctggttaatgttcttaggc
ttatacttgggacgtgaagatgctgcgaaaactataatcgatgaaaaattccctgaactg
gggtcagtagaggaagagtttcaagaaatgagctgggttgcatccacggctttcttatca
ggattagaaacagtctctgagttaaacaacaggttcttgaaatttgatgaaagagctttt
aagactaaagttgattttactaaagaaccagtaccactaaacgtgtttagacgtgcatta
gagatgttgtcagaacagcccggtgggtttatagctctaaatggttttggagggaaaatg
agcgaaattagcactgattttaccccgtttcctcatcggaaaggcactaaattgatgttc
gaatatataatcgcttggaaccaagatgaagaaacgaaaatcgaagaatttagcgaatgg
ttaacgaagttttacgattatttggagccgttcgtatcgaaaggaccaagggttggttat
gttaatcatattgatcttgagattggagggatagattggaggaataaaagtagtactagc
aatgcagttgagattgctagaaattggggcgaaaggtatttttcatcgaattatgaacgt
ttggttaaggcgaagacattgattgatccaaataatgtgtttaaccatccacagagtatt
cctccaatgatgaaatttgaggaaaattacatgttgaaggaactgtag

DBGET integrated database retrieval system